Result : EXP01658
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01658 |
| NCBI Accession ID | NC_003210.1 |
| Organism | Listeria monocytogenes strain EGD |
| Left | 1277024 |
| Right | 1277161 |
| Strand | - |
| Nucleotide Sequence | ATGACTAAAGTTATTTTAACTATTTTTGCAATTATTGTTCCCGCGTTTCTTGGATTTATACTTGCTTACCAAATCTATAAGAAAAAAACAGCCACTTATATGCCATTAAAAAATGAATTTGTACACTGGGCTAAATAA |
| Sequence | MTKVILTIFAIIVPAFLGFILAYQIYKKKTATYMPLKNEFVHWAK |
| Source of smORF | Literature |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 45 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1277024 | 1277161 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 2 | 1307209 | 1307346 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 3 | 1190483 | 1190620 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 4 | 1261149 | 1261286 | - | NZ_LT906444.1 | Listeria welshimeri |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003210.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13545.8 | 1.0 | 4 | 1479.5 | opposite-strand | Crp-like helix-turn-helix domain |
| 2 | PF00027.31 | 1.0 | 4 | 1479.5 | opposite-strand | Cyclic nucleotide-binding domain |
| 3 | PF02588.17 | 1.0 | 4 | 329.0 | same-strand | Uncharacterised 5xTM membrane BCR, YitT family COG1284 |
| 4 | PF10035.11 | 1.0 | 4 | 329.0 | same-strand | Uncharacterized protein conserved in bacteria (DUF2179) |
| 5 | PF07702.15 | 1.0 | 4 | 150.0 | opposite-strand | UTRA domain |
| 6 | PF00392.23 | 1.0 | 4 | 150.0 | opposite-strand | Bacterial regulatory proteins, gntR family |
| 7 | PF00128.26 | 0.75 | 3 | 895 | same-strand | Alpha amylase, catalytic domain |
| 8 | PF11941.10 | 0.75 | 3 | 895 | same-strand | Domain of unknown function (DUF3459) |
| 9 | PF02378.20 | 1.0 | 4 | 2560.0 | same-strand | Phosphotransferase system, EIIC |
| 10 | PF00367.22 | 1.0 | 4 | 2560.0 | same-strand | phosphotransferase system, EIIB |
| 11 | PF00293.30 | 0.75 | 3 | 4159 | opposite-strand | NUDIX domain |
++ More..