Result : EXP01653
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01653 |
| NCBI Accession ID | NC_017548.1 |
| Organism | Pseudomonas aeruginosa M18 |
| Left | 5335634 |
| Right | 5335906 |
| Strand | + |
| Nucleotide Sequence | ATGAACGACGAACTGCTGAATCTGAAAAACCTCGGGAAAACCTCGACCCAATGGTTGCATGCCGTGGGTATCCACAGCGCCACCGATCTGCGTCGGCTCGGCTCGGTGGGAGCCTATCGCGCGGTCCGCGCGCGCGGCTTCCGAGCCTCGAAAGTCTTGCTCTATGCCATCGAAGGCGCACTCCTCGACGTTCACTGGAACGAGCTGTCCCCAGACCACAAGGCCGCACTGCTCGGCGAGCTGGAGACTTTCCCCGTGCGAAACAAGAGCTAG |
| Sequence | MNDELLNLKNLGKTSTQWLHAVGIHSATDLRRLGSVGAYRAVRARGFRASKVLLYAIEGALLDVHWNELSPDHKAALLGELETFPVRNKS |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl22429. Profile Description: Helix-hairpin-helix domain. The HHH domain is a short DNA-binding domain. |
| Pubmed ID | 30796087 |
| Domain | CDD:419830 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 57
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5282732 | 5283004 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 2 | 5204394 | 5204681 | + | NZ_CP047698.1 | Pseudomonas knackmussii |
| 3 | 1653383 | 1653655 | - | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 4 | 5968720 | 5968992 | + | NZ_CP014158.1 | Pseudomonas citronellolis |
| 5 | 5216710 | 5216982 | + | NZ_AP022642.1 | Pseudomonas otitidis |
| 6 | 4210451 | 4210723 | + | NZ_CP068551.1 | Pseudomonas khazarica |
| 7 | 5070915 | 5071187 | + | NZ_CP043311.1 | Pseudomonas lalkuanensis |
| 8 | 5273246 | 5273518 | + | NZ_AP014862.1 | Pseudomonas furukawaii |
| 9 | 1080694 | 1080966 | + | NZ_CP070505.1 | Pseudomonas toyotomiensis |
| 10 | 1162774 | 1163046 | - | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
| 11 | 1431002 | 1431274 | - | NZ_CP060009.1 | Pseudomonas sediminis |
| 12 | 3782568 | 3782840 | + | NZ_LR215729.2 | Pseudomonas marincola |
| 13 | 4908550 | 4908822 | - | NZ_CP005960.1 | Pseudomonas mandelii JR-1 |
| 14 | 5146087 | 5146359 | + | NZ_CP023272.1 | Pseudomonas lurida |
| 15 | 874225 | 874497 | - | NZ_CP056030.1 | Pseudomonas eucalypticola |
| 16 | 5677021 | 5677293 | + | NZ_CP035088.1 | Pseudomonas viciae |
| 17 | 4948913 | 4949185 | + | NZ_CP027723.1 | Pseudomonas orientalis |
| 18 | 5349228 | 5349500 | + | NZ_CP029608.1 | Pseudomonas kribbensis |
| 19 | 1086059 | 1086331 | - | NZ_CP070503.1 | Pseudomonas atacamensis |
| 20 | 5220225 | 5220497 | - | NZ_CP048810.1 | Pseudomonas bijieensis |
| 21 | 5895457 | 5895729 | + | NZ_CP051487.1 | Pseudomonas umsongensis |
| 22 | 804475 | 804747 | - | NZ_CP014870.1 | Pseudomonas silesiensis |
| 23 | 5737695 | 5737967 | + | NZ_CP034725.1 | Pseudomonas brassicacearum |
| 24 | 5032593 | 5032865 | + | NZ_CP054205.1 | Pseudomonas rhodesiae |
| 25 | 5704768 | 5705040 | + | NZ_CP014205.2 | Pseudomonas glycinae |
| 26 | 5548815 | 5549087 | + | NZ_CP062253.1 | Pseudomonas gozinkensis |
| 27 | 5570107 | 5570379 | + | NZ_CP062252.1 | Pseudomonas allokribbensis |
| 28 | 5810927 | 5811199 | + | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 29 | 5190675 | 5190947 | + | NZ_CP010896.1 | Pseudomonas simiae |
| 30 | 2556844 | 2557116 | + | NZ_CP014262.1 | Pseudomonas corrugata |
| 31 | 5484729 | 5485001 | + | NZ_CP027756.1 | Pseudomonas synxantha |
| 32 | 5847228 | 5847500 | + | NZ_LS999205.1 | Pseudomonas protegens CHA0 |
| 33 | 5642266 | 5642538 | + | NZ_CP012400.2 | Pseudomonas yamanorum |
| 34 | 5836831 | 5837103 | + | NZ_CP018420.1 | Pseudomonas veronii |
| 35 | 904625 | 904897 | - | NZ_CP046621.1 | Pseudomonas alkylphenolica |
| 36 | 769352 | 769630 | - | NZ_CP024159.1 | Pseudomonas mosselii |
| 37 | 4145542 | 4145826 | + | NZ_CP009365.1 | Pseudomonas soli |
| 38 | 5016674 | 5016952 | + | NC_008027.1 | Pseudomonas entomophila L48 |
| 39 | 4957385 | 4957669 | + | NZ_CP071706.1 | Pseudomonas donghuensis |
| 40 | 2674819 | 2675097 | + | NZ_CP031146.1 | Pseudomonas plecoglossicida |
| 41 | 5138746 | 5139018 | + | NZ_CP049044.1 | Pseudomonas psychrophila |
| 42 | 5286498 | 5286776 | + | NC_021505.1 | Pseudomonas putida NBRC 14164 |
| 43 | 3700560 | 3700832 | + | NZ_CP012676.1 | Pseudomonas versuta |
| 44 | 5045250 | 5045528 | + | NZ_CP022562.1 | Pseudomonas monteilii |
| 45 | 4063755 | 4064027 | + | NZ_CP062158.2 | Pseudomonas lundensis |
| 46 | 2873530 | 2873802 | + | NZ_CP009533.1 | Pseudomonas rhizosphaerae |
| 47 | 4297269 | 4297493 | + | NC_007912.1 | Saccharophagus degradans 2-40 |
| 48 | 5688376 | 5688651 | + | NZ_CP048878.1 | Spartinivicinus ruber |
| 49 | 373494 | 373763 | + | NZ_CP060092.1 | Teredinibacter purpureus |
| 50 | 3133559 | 3133822 | + | NZ_CP047491.1 | Microbulbifer hydrolyticus |
| 51 | 1625412 | 1625669 | + | NC_018868.3 | Simiduia agarivorans SA1 = DSM 21679 |
| 52 | 3234159 | 3234422 | + | NZ_CP019650.1 | Microbulbifer agarilyticus |
| 53 | 1913262 | 1913546 | - | NZ_CP014143.1 | Microbulbifer aggregans |
| 54 | 632763 | 632993 | - | NZ_CP020038.1 | Agarilytica rhodophyticola |
| 55 | 1000110 | 1000370 | - | NZ_CP014864.1 | Microbulbifer thermotolerans |
| 56 | 634050 | 634301 | - | NC_010995.1 | Cellvibrio japonicus Ueda107 |
| 57 | 4453380 | 4453652 | - | NZ_CP060084.1 | Teredinibacter haidensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP005960.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04287.14 | 0.77 | 44 | 5392.0 | opposite-strand | tRNA pseudouridine synthase C |
| 2 | PF00912.24 | 0.82 | 47 | 2316 | opposite-strand | Transglycosylase |
| 3 | PF14814.8 | 0.82 | 47 | 2316 | opposite-strand | Bifunctional transglycosylase second domain |
| 4 | PF00905.24 | 0.82 | 47 | 2316 | opposite-strand | Penicillin binding protein transpeptidase domain |
| 5 | PF13671.8 | 0.81 | 46 | 642.0 | same-strand | AAA domain |
| 6 | PF00805.24 | 0.61 | 35 | 219 | same-strand | Pentapeptide repeats (8 copies) |
| 7 | PF00005.29 | 0.75 | 43 | 1137 | opposite-strand | ABC transporter |
| 8 | PF01032.20 | 0.72 | 41 | 1883 | opposite-strand | FecCD transport family |
| 9 | PF01497.20 | 0.61 | 35 | 2905 | opposite-strand | Periplasmic binding protein |
| 10 | PF00355.28 | 0.63 | 36 | 3082.5 | same-strand | Rieske [2Fe-2S] domain |
++ More..