Result : B2URC9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | CP001071.1 |
| Organism | Akkermansia muciniphila (strain ATCC BAA-835 / Muc) |
| Left | 1425427 |
| Right | 1425690 |
| Strand | - |
| Nucleotide Sequence | ATGTCCCGAATTTGCATCATCAGAGGTACCATGCCTCACAAAGGTCGTCGTATCCATCGCTCCGGTCTTGCCAAGAAAAAGGGCGGTATTGGTCGTCACGTCACTAAGACTGTCAATCGTACCGTTTTCCCCAACCTTCAGGAGAAGCGCATCTGGGTTCCTGAACTCGGTCAATTCGTGAAAATGAAGATTTCCGCCAAGGCCCTGCGTACGATCAACAAGAACGGTGCTTACAACACTCTTAAAAAAGTAGGTCTCCTGTAA |
| Sequence | MSRICIIRGTMPHKGRRIHRSGLAKKKGGIGRHVTKTVNRTVFPNLQEKRIWVPELGQFVKMKISAKALRTINKNGAYNTLKKVGLL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 21390229 |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B2URC9 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1489495 | 1489758 | - | NZ_AP021898.1 | Akkermansia muciniphila |
| 2 | 1289237 | 1289500 | + | NZ_LT629973.1 | Akkermansia glycaniphila |
| 3 | 2063687 | 2063950 | + | NZ_CP051774.1 | Luteolibacter luteus |
| 4 | 1014897 | 1015160 | - | NZ_CP037899.1 | Methylacidiphilum kamchatkense Kam1 |
| 5 | 960169 | 960432 | - | NC_010794.1 | Methylacidiphilum infernorum V4 |
++ More..