Result : EXP01648
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01648 |
| NCBI Accession ID | NC_017381.1 |
| Organism | Helicobacter pylori 2018 |
| Left | 1286449 |
| Right | 1286661 |
| Strand | - |
| Nucleotide Sequence | GTGAGAGCGAAAATGAAATATACTGAATTGAAAGATAAAAGTATCAAGGAATTAGAAGAGTTGTTGCATGCTAAGAAAGCGGAGCTTTTTGAGTTGCGCGTTAAGTTAAAGACCATGCAATTGAGTAATCCTAATGAGATTAAGAAAGCTAGAAGAAATATCGCTCGCATTAACACAGCTATTAATGCGTATTATTCTTCTAGCGTTGAGTAA |
| Sequence | VRAKMKYTELKDKSIKELEELLHAKKAELFELRVKLKTMQLSNPNEIKKARRNIARINTAINAYYSSSVE |
| Source of smORF | Protein-level |
| Function | translation [GO:0006412];cytosolic large ribosomal subunit [GO:0022625];structural constituent of ribosome [GO:0003735] The ORF matches to the profile of cl09943. Profile Description: N/A. This family represents the N-terminal region (approximately 8 residues) of the eukaryotic mitochondrial 39-S ribosomal protein L47 (MRP-L47). Mitochondrial ribosomal proteins (MRPs) are the counterparts of the cytoplasmic ribosomal proteins, in that they fulfil similar functions in protein biosynthesis. However, they are distinct in number, features and primary structure. |
| Pubmed ID | 30796087 |
| Domain | CDD:415815 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | P56052 |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 117
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 129077 | 129289 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 2 | 1362596 | 1362808 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 3 | 842909 | 843118 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 4 | 1736960 | 1737154 | - | NZ_CP012541.1 | Campylobacter concisus |
| 5 | 158979 | 159167 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 6 | 1850951 | 1851142 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 7 | 1981820 | 1982008 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 8 | 2047879 | 2048073 | - | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 9 | 2021327 | 2021512 | - | NZ_CP012544.1 | Campylobacter showae |
| 10 | 68442 | 68627 | + | NZ_CP012543.1 | Campylobacter rectus |
| 11 | 1173460 | 1173651 | - | NZ_LS483446.1 | Helicobacter mustelae |
| 12 | 1249251 | 1249436 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 13 | 586085 | 586273 | + | NZ_AP018676.1 | Helicobacter cinaedi |
| 14 | 91905 | 92090 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 15 | 1353536 | 1353727 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 16 | 1671306 | 1671491 | - | NZ_CP053831.1 | Campylobacter mucosalis |
| 17 | 1616057 | 1616242 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 18 | 103781 | 103966 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 19 | 1527262 | 1527447 | - | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 20 | 61309 | 61494 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 21 | 32452 | 32637 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 22 | 70431 | 70616 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 23 | 694621 | 694806 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 24 | 63690 | 63875 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 25 | 58279 | 58464 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 26 | 1334423 | 1334596 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 27 | 844273 | 844458 | + | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 28 | 1268803 | 1268976 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 29 | 61930 | 62115 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 30 | 109512 | 109682 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 31 | 787111 | 787302 | + | NZ_CP035928.1 | Malaciobacter pacificus |
| 32 | 1867647 | 1867832 | - | NZ_CP035946.1 | Campylobacter canadensis |
| 33 | 1832299 | 1832484 | - | NZ_CP053826.1 | Campylobacter curvus |
| 34 | 105237 | 105428 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 35 | 15291 | 15476 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 36 | 931935 | 932126 | + | NZ_CP019070.1 | Poseidonibacter parvus |
| 37 | 185873 | 186055 | + | NZ_CP012196.1 | Campylobacter gracilis |
| 38 | 37925 | 38110 | + | NZ_CP059443.1 | Campylobacter fetus |
| 39 | 726745 | 726936 | + | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 40 | 1686825 | 1687010 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 41 | 1782828 | 1783013 | - | NZ_CP053841.1 | Campylobacter blaseri |
| 42 | 1576746 | 1576931 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 43 | 59291 | 59476 | + | NZ_CP020478.1 | Campylobacter helveticus |
| 44 | 611219 | 611410 | + | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 45 | 975075 | 975260 | + | NZ_CP042812.1 | Malaciobacter canalis |
| 46 | 946074 | 946259 | + | NZ_CP032101.1 | Malaciobacter marinus |
| 47 | 572431 | 572622 | + | NZ_CP036246.2 | [Arcobacter] porcinus |
| 48 | 675313 | 675504 | + | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 49 | 1481896 | 1482087 | - | NZ_CP053837.1 | Aliarcobacter faecis |
| 50 | 1087935 | 1088126 | + | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 51 | 1612831 | 1613022 | - | NZ_CP054051.1 | Aliarcobacter cibarius |
| 52 | 1590885 | 1591076 | - | NZ_CP053842.1 | Campylobacter corcagiensis |
| 53 | 640008 | 640199 | + | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 54 | 877900 | 878085 | + | NZ_CP031218.1 | Malaciobacter halophilus |
| 55 | 952291 | 952482 | + | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 56 | 814652 | 814843 | + | NZ_CP030944.1 | Arcobacter aquimarinus |
| 57 | 869435 | 869626 | + | NZ_CP053833.1 | Arcobacter cloacae |
| 58 | 1612479 | 1612652 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 59 | 911555 | 911746 | + | NZ_CP053835.1 | Arcobacter defluvii |
| 60 | 938204 | 938395 | + | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 61 | 1059491 | 1059682 | + | NZ_CP053840.1 | Arcobacter venerupis |
| 62 | 889268 | 889459 | + | NZ_CP032097.1 | Arcobacter ellisii |
| 63 | 975353 | 975544 | + | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 64 | 727735 | 727926 | + | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 65 | 935698 | 935886 | + | NZ_CP041070.1 | Arcobacter anaerophilus |
| 66 | 950100 | 950291 | + | NZ_CP053836.1 | Halarcobacter ebronensis |
| 67 | 1394171 | 1394362 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 68 | 2437083 | 2437271 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 69 | 196856 | 197041 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 70 | 424178 | 424366 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 71 | 2594620 | 2594808 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 72 | 661529 | 661723 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 73 | 1529995 | 1530201 | - | NC_012115.1 | Nautilia profundicola AmH |
| 74 | 155467 | 155643 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 75 | 173485 | 173673 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 76 | 215617 | 215805 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 77 | 181716 | 181916 | + | NZ_CP029295.1 | Mycoplasma phocidae |
| 78 | 2139203 | 2139394 | + | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 79 | 345634 | 345840 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 80 | 1586487 | 1586693 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 81 | 67923 | 68120 | + | NZ_CP021886.1 | Helicobacter apodemus |
| 82 | 1302481 | 1302657 | - | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 83 | 986070 | 986276 | - | NZ_CP014234.1 | Moraxella osloensis |
| 84 | 2869068 | 2869259 | - | NC_005363.1 | Bdellovibrio bacteriovorus HD100 |
| 85 | 2069078 | 2069287 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 86 | 289747 | 289941 | - | NZ_CP059563.1 | Conchiformibius steedae |
| 87 | 1611235 | 1611426 | + | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 88 | 157971 | 158168 | - | NZ_LR134343.1 | Moraxella cuniculi |
| 89 | 315639 | 315842 | + | NZ_CP030103.1 | Mycoplasma cloacale |
| 90 | 1518066 | 1518269 | - | NC_021291.1 | Spiribacter salinus M19-40 |
| 91 | 2377980 | 2378156 | - | NZ_CP007446.1 | Snodgrassella alvi wkB2 |
| 92 | 1910420 | 1910596 | - | NZ_CP031253.1 | Neisseria lactamica |
| 93 | 1556098 | 1556295 | - | NC_014147.1 | Moraxella catarrhalis BBH18 |
| 94 | 1956731 | 1956907 | - | NZ_CP072524.1 | Neisseria sicca |
| 95 | 1695278 | 1695454 | + | NZ_LS483369.1 | Neisseria cinerea |
| 96 | 919006 | 919197 | - | NZ_CP022278.1 | Neisseria chenwenguii |
| 97 | 152499 | 152699 | - | NZ_AP014657.1 | Mycoplasmopsis arginini |
| 98 | 936291 | 936482 | - | NZ_CP031325.1 | Neisseria polysaccharea |
| 99 | 1726724 | 1726915 | - | NZ_CP021520.1 | Neisseria meningitidis |
| 100 | 1055113 | 1055304 | + | NZ_CP012028.1 | Neisseria gonorrhoeae |
| 101 | 2571319 | 2571525 | + | NZ_CP070062.1 | Coprococcus comes |
| 102 | 408335 | 408544 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 103 | 336742 | 336951 | + | NZ_LN879430.1 | Herbinix luporum |
| 104 | 1512034 | 1512225 | + | NZ_CP072425.1 | Pseudoalteromonas viridis |
| 105 | 1522307 | 1522501 | - | NZ_CP014161.1 | Aerococcus urinae |
| 106 | 387886 | 388071 | - | NZ_AP022345.1 | Fluviibacter phosphoraccumulans |
| 107 | 339494 | 339694 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 108 | 3587043 | 3587234 | - | NZ_CP013187.1 | Pseudoalteromonas phenolica |
| 109 | 5089754 | 5089966 | - | NZ_CP039126.1 | Blautia producta |
| 110 | 2515211 | 2515414 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 111 | 505384 | 505587 | + | NZ_CP030280.1 | Blautia argi |
| 112 | 1617176 | 1617385 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 113 | 1790538 | 1790729 | - | NZ_CP039887.1 | Neisseria subflava |
| 114 | 1956412 | 1956603 | + | NZ_CP039886.1 | Neisseria flavescens |
| 115 | 3856595 | 3856798 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 116 | 181005 | 181205 | + | NZ_LS991949.1 | Mycoplasma alkalescens |
| 117 | 757494 | 757703 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012541.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03947.20 | 0.97 | 113 | 1744 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 2 | PF00181.25 | 0.97 | 113 | 1744 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 3 | PF00203.23 | 0.96 | 112 | 1458.0 | same-strand | Ribosomal protein S19 |
| 4 | PF00237.21 | 0.99 | 116 | 1118.0 | same-strand | Ribosomal protein L22p/L17e |
| 5 | PF00189.22 | 0.99 | 116 | 415.0 | same-strand | Ribosomal protein S3, C-terminal domain |
| 6 | PF07650.19 | 0.97 | 114 | 415.0 | same-strand | KH domain |
| 7 | PF00252.20 | 0.94 | 110 | -13.0 | same-strand | Ribosomal protein L16p/L10e |
| 8 | PF00366.22 | 0.99 | 116 | 10.0 | same-strand | Ribosomal protein S17 |
| 9 | PF00238.21 | 0.97 | 114 | 262.0 | same-strand | Ribosomal protein L14p/L23e |
| 10 | PF00467.31 | 0.97 | 114 | 632.0 | same-strand | KOW motif |
| 11 | PF00673.23 | 0.95 | 111 | 872 | same-strand | ribosomal L5P family C-terminus |
| 12 | PF00281.21 | 0.98 | 115 | 872 | same-strand | Ribosomal protein L5 |
| 13 | PF00253.23 | 0.82 | 96 | 1419.5 | same-strand | Ribosomal protein S14p/S29e |
++ More..