ProsmORF-pred
Result : EXP01645
Protein Information
Information Type Description
Protein name EXP01645
NCBI Accession ID NC_000911.1
Organism Synechocystis
Left 1842716
Right 1842856
Strand -
Nucleotide Sequence ATGTCAGACCTGAACCGTGGCATCATGAAATTCGACGGGGCAGATAAGCCCTTCCTCGTCGCTGTTTCGGCAATGTTAATCCTGGGGGGCATTGGTGCCCTGATTATCTGGGCCCTACGGGTAGCCTACGCTGTGGGCTAG
Sequence MSDLNRGIMKFDGADKPFLVAVSAMLILGGIGALIIWALRVAYAVG
Source of smORF Literature
Function
Pubmed ID 30796087
Domain
Functional Category Function not yet assigned
Uniprot ID
ORF Length (Amino Acid) 46
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 26
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2232300 2232440 + NC_019776.1 Cyanobacterium aponinum PCC 10605
2 310454 310594 - NC_019689.1 Pleurocapsa sp. PCC 7327
3 2779856 2779996 - NC_011729.1 Gloeothece citriformis PCC 7424
4 1119063 1119203 + NC_014501.1 Gloeothece verrucosa PCC 7822
5 221273 221413 - NZ_CP042326.1 Euhalothece natronophila Z-M001
6 1015660 1015797 + NC_019695.1 Chroococcidiopsis thermalis PCC 7203
7 1894821 1894961 + NZ_AP014638.1 Leptolyngbya boryana IAM M-101
8 5044675 5044815 + NC_019771.1 Anabaena cylindrica PCC 7122
9 1350322 1350462 - NC_019751.1 Calothrix sp. PCC 6303
10 1304404 1304544 + NZ_CP031941.1 Nostoc sphaeroides
11 2300597 2300737 + NC_019748.1 Stanieria cyanosphaera PCC 7437
12 679074 679214 + NZ_CP024785.1 Nostoc flagelliforme CCNUN1
13 119748 119888 + NC_014248.1 'Nostoc azollae' 0708
14 1588520 1588660 + NC_010628.1 Nostoc punctiforme PCC 73102
15 1109060 1109200 - NZ_CP054698.1 Nostoc edaphicum CCNP1411
16 1735271 1735411 + NZ_CP060822.1 Cylindrospermopsis curvispora GIHE-G1
17 1859257 1859397 - NZ_CP047242.1 Trichormus variabilis 0441
18 685714 685854 - NC_019693.1 Oscillatoria acuminata PCC 6304
19 105314 105451 + NC_004113.1 Thermosynechococcus vestitus BP-1
20 2443377 2443514 - NZ_AP018202.1 Thermostichus vulcanus NIES-2134
21 6006009 6006149 + NC_019729.1 Oscillatoria nigro-viridis PCC 7112
22 674193 674330 - NZ_CP018092.1 Synechococcus lividus PCC 6715
23 2348759 2348884 + NC_009925.1 Acaryochloris marina MBIC11017
24 4993696 4993836 - NC_019753.1 Crinalium epipsammum PCC 9333
25 2410129 2410269 + NC_019780.1 Dactylococcopsis salina PCC 8305
26 180869 181003 - NC_010296.1 Microcystis aeruginosa NIES-843
++ More..