| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01633 |
| NCBI Accession ID | BA000022.2 |
| Organism | Synechocystis sp. PCC 6803 |
| Left | 2564175 |
| Right | 2564390 |
| Strand | + |
| Nucleotide Sequence | ATGACTTCTGACCCCATTACCCTCCTCGTCAACGGCGATCGCCAAATCGCTTCTAGTCCAGTTACATTGCCGGATTTTTTGCAAAATCAAGGGTTTAACCTCCGCTTAATTGCGGTGGAATACAACGGTGAAATTCTCCATCGACAATTTTGGCCGGAAACCCAATTGCAAAACGGCGATCGCCTGGAGGTAGTTACCATTGTGGGAGGCGGCTAG |
| Sequence | MTSDPITLLVNGDRQIASSPVTLPDFLQNQGFNLRLIAVEYNGEILHRQFWPETQLQNGDRLEVVTIVGGG |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl28922. Profile Description: Beta-grasp ubiquitin-like fold. This domain is the binding/interacting region of several protein kinases, such as the Schizosaccharomyces pombe Byr2. Byr2 is a Ser/Thr-specific protein kinase acting as mediator of signals for sexual differentiation in S. pombe by initiating a MAPK module, which is a highly conserved element in eukaryotes. Byr2 is activated by interacting with Ras, which then translocates the molecule to the plasma membrane. Ras proteins are key elements in intracellular signaling and are involved in a variety of vital processes such as DNA transcription, growth control, and differentiation. They function like molecular switches cycling between GTP-bound 'on' and GDP-bound 'off' states. |
| Pubmed ID | 30796087 |
| Domain | CDD:421700 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 71 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1264155 | 1264367 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 2 | 4076392 | 4076604 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 3 | 887347 | 887568 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 4 | 6289709 | 6289921 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 5 | 4997911 | 4998123 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 6 | 5242021 | 5242233 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 7 | 3391290 | 3391484 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 8 | 2201133 | 2201342 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 9 | 5408102 | 5408314 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 10 | 4526427 | 4526615 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 11 | 2088847 | 2089068 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 12 | 927422 | 927628 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 13 | 5523542 | 5523754 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 14 | 1953223 | 1953426 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 15 | 906162 | 906377 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 16 | 2004392 | 2004580 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 17 | 3929349 | 3929543 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 18 | 3237780 | 3238007 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 19 | 3476619 | 3476840 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 20 | 1353160 | 1353381 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 21 | 282093 | 282329 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 22 | 1554926 | 1555114 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 23 | 3802718 | 3802930 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 24 | 4572004 | 4572216 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 25 | 1534591 | 1534779 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02581.19 | 0.88 | 22 | 70.5 | same-strand | Thiamine monophosphate synthase |
| 2 | PF17792.3 | 0.88 | 22 | 70.5 | same-strand | ThiD2 family |