Result : EXP01633

Protein Information

• Protein name: EXP01633
• NCBI Accession ID: BA000022.2
• Organism: Synechocystis sp. PCC 6803
• Left: 2564175
• Right: 2564390
• Strand: +
• Nucleotide Sequence: ATGACTTCTGACCCCATTACCCTCCTCGTCAACGGCGATCGCCAAATCGCTTCTAGTCCAGTTACATTGCCGGATTTTTTGCAAAATCAAGGGTTTAACCTCCGCTTAATTGCGGTGGAATACAACGGTGAAATTCTCCATCGACAATTTTGGCCGGAAACCCAATTGCAAAACGGCGATCGCCTGGAGGTAGTTACCATTGTGGGAGGCGGCTAG
• Sequence: MTSDPITLLVNGDRQIASSPVTLPDFLQNQGFNLRLIAVEYNGEILHRQFWPETQLQNGDRLEVVTIVGGG
• Source of smORF: Protein-level
• Function: The ORF matches to the profile of cl28922. Profile Description: Beta-grasp ubiquitin-like fold. This domain is the binding/interacting region of several protein kinases, such as the Schizosaccharomyces pombe Byr2. Byr2 is a Ser/Thr-specific protein kinase acting as mediator of signals for sexual differentiation in S. pombe by initiating a MAPK module, which is a highly conserved element in eukaryotes. Byr2 is activated by interacting with Ras, which then translocates the molecule to the plasma membrane. Ras proteins are key elements in intracellular signaling and are involved in a variety of vital processes such as DNA transcription, growth control, and differentiation. They function like molecular switches cycling between GTP-bound 'on' and GDP-bound 'off' states.
• Pubmed ID: 30796087
• Domain: CDD:421700
• Functional Category: Conserved domain based functional assignment
• ORF Length (Amino Acid): 71

Conservation Analysis

No. of Species: 25

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1264155	1264367	-	NZ_CP047242.1	Trichormus variabilis 0441
2	4076392	4076604	+	NZ_CP024785.1	Nostoc flagelliforme CCNUN1
3	887347	887568	+	NZ_CP021983.2	Halomicronema hongdechloris C2206
4	6289709	6289921	-	NZ_CP054698.1	Nostoc edaphicum CCNP1411
5	4997911	4998123	-	NC_010628.1	Nostoc punctiforme PCC 73102
6	5242021	5242233	+	NC_019771.1	Anabaena cylindrica PCC 7122
7	3391290	3391484	-	NC_014248.1	'Nostoc azollae' 0708
8	2201133	2201342	-	NC_019695.1	Chroococcidiopsis thermalis PCC 7203
9	5408102	5408314	+	NZ_CP031941.1	Nostoc sphaeroides
10	4526427	4526615	+	NZ_AP014638.1	Leptolyngbya boryana IAM M-101
11	2088847	2089068	+	NC_019748.1	Stanieria cyanosphaera PCC 7437
12	927422	927628	-	NZ_CP060822.1	Cylindrospermopsis curvispora GIHE-G1
13	5523542	5523754	-	NC_014501.1	Gloeothece verrucosa PCC 7822
14	1953223	1953426	+	NC_009925.1	Acaryochloris marina MBIC11017
15	906162	906377	-	NC_019776.1	Cyanobacterium aponinum PCC 10605
16	2004392	2004580	+	NC_019689.1	Pleurocapsa sp. PCC 7327
17	3929349	3929543	+	NC_010296.1	Microcystis aeruginosa NIES-843
18	3237780	3238007	-	NC_011729.1	Gloeothece citriformis PCC 7424
19	3476619	3476840	-	NC_019753.1	Crinalium epipsammum PCC 9333
20	1353160	1353381	-	NC_019780.1	Dactylococcopsis salina PCC 8305
21	282093	282329	+	NZ_CP042326.1	Euhalothece natronophila Z-M001
22	1554926	1555114	-	NC_019693.1	Oscillatoria acuminata PCC 6304
23	3802718	3802930	+	NC_019729.1	Oscillatoria nigro-viridis PCC 7112
24	4572004	4572216	-	NC_019751.1	Calothrix sp. PCC 6303
25	1534591	1534779	-	NZ_CP018092.1	Synechococcus lividus PCC 6715

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP047242.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF02581.19	0.88	22	70.5	same-strand	Thiamine monophosphate synthase
2	PF17792.3	0.88	22	70.5	same-strand	ThiD2 family