Protein Information |
Information Type | Description |
---|---|
Protein name | 30S ribosomal protein S21 |
NCBI Accession ID | CP001071.1 |
Organism | Akkermansia muciniphila (strain ATCC BAA-835 / Muc) |
Left | 496854 |
Right | 497105 |
Strand | + |
Nucleotide Sequence | ATGCGTGAAGTTACCGTAAGAAAAGGTGAACCTATCGACCGCGCTCTCAAGCGCCTCAAAACAAAACTGGATGTTGAAGGCATTCTGGATGAAATGCGCCGCCGCCGCGCCTTTGAAACCCCGATGGACGAACGCCGCCGCAAGGCCCGTTCCGCCAGCAAGCGCAACAAGGTAAAATGGCGTTACAGCAACAAGAGCGAAGAAACCGCTTCCGAAACTGCTGAAACACCCGCTTCCGCTCCTGAAGCTTAA |
Sequence | MREVTVRKGEPIDRALKRLKTKLDVEGILDEMRRRRAFETPMDERRRKARSASKRNKVKWRYSNKSEETASETAETPASAPEA |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00529. Profile Description: Ribosomal protein S21. 30S ribosomal protein S21; Reviewed |
Pubmed ID | 21390229 |
Domain | CDD:412427 |
Functional Category | Ribosomal_protein |
Uniprot ID | B2UNE2 |
ORF Length (Amino Acid) | 83 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 536049 | 536300 | + | NZ_AP021898.1 | Akkermansia muciniphila |
2 | 778869 | 779108 | + | NZ_LT629973.1 | Akkermansia glycaniphila |
3 | 4093434 | 4093679 | - | NZ_CP051774.1 | Luteolibacter luteus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00202.23 | 0.67 | 2 | 82.0 | same-strand | Aminotransferase class-III |
2 | PF04055.23 | 0.67 | 2 | 2752.5 | both-strands | Radical SAM superfamily |