Result : B2UNE2

Protein Information

• Protein name: 30S ribosomal protein S21
• NCBI Accession ID: CP001071.1
• Organism: Akkermansia muciniphila (strain ATCC BAA-835 / Muc)
• Left: 496854
• Right: 497105
• Strand: +
• Nucleotide Sequence: ATGCGTGAAGTTACCGTAAGAAAAGGTGAACCTATCGACCGCGCTCTCAAGCGCCTCAAAACAAAACTGGATGTTGAAGGCATTCTGGATGAAATGCGCCGCCGCCGCGCCTTTGAAACCCCGATGGACGAACGCCGCCGCAAGGCCCGTTCCGCCAGCAAGCGCAACAAGGTAAAATGGCGTTACAGCAACAAGAGCGAAGAAACCGCTTCCGAAACTGCTGAAACACCCGCTTCCGCTCCTGAAGCTTAA
• Sequence: MREVTVRKGEPIDRALKRLKTKLDVEGILDEMRRRRAFETPMDERRRKARSASKRNKVKWRYSNKSEETASETAETPASAPEA
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of cl00529. Profile Description: Ribosomal protein S21. 30S ribosomal protein S21; Reviewed
• Pubmed ID: 21390229
• Domain: CDD:412427
• Functional Category: Ribosomal_protein
• Uniprot ID: B2UNE2
• ORF Length (Amino Acid): 83

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	536049	536300	+	NZ_AP021898.1	Akkermansia muciniphila
2	778869	779108	+	NZ_LT629973.1	Akkermansia glycaniphila
3	4093434	4093679	-	NZ_CP051774.1	Luteolibacter luteus

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_LT629973.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00202.23	0.67	2	82.0	same-strand	Aminotransferase class-III
2	PF04055.23	0.67	2	2752.5	both-strands	Radical SAM superfamily