Result : EXP01627
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01627 |
| NCBI Accession ID | NC_017340.1 |
| Organism | Staphylococcus aureus 04-02981 |
| Left | 1203858 |
| Right | 1204148 |
| Strand | + |
| Nucleotide Sequence | ATGGATATAAATGTGCTAGCTACAATATTTAAATTTATCCTTTTTGTTGTTGAAATTTATTATTTCGGCATGATTATATATTTCTTTACATCTTGGGTACCAAGTATTAGAGAAACTAAGGTAGGTTATTTTTTAGCGAAAATATATGAACCTTTCTTACAACCATTTAGAAAAGTAATTCCACCTATTGGAATTATCGACATATCATCAATCGCTGCAATTATCGTTTTAGTATTATTCCAAAAAGGGTTACTCCAAATCTTTAATTGGATTTTAATTCAATTACAATAA |
| Sequence | MDINVLATIFKFILFVVEIYYFGMIIYFFTSWVPSIRETKVGYFLAKIYEPFLQPFRKVIPPIGIIDISSIAAIIVLVLFQKGLLQIFNWILIQLQ |
| Source of smORF | Protein-level |
| Function | integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] The ORF matches to the profile of cl00508. Profile Description: YGGT family. This family consists of a repeat found in conserved hypothetical integral membrane proteins. The function of this region and the proteins which possess it is unknown. |
| Pubmed ID | 30796087 |
| Domain | CDD:412415 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | O31729 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 52
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1105089 | 1105379 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1175580 | 1175870 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1131331 | 1131621 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 1658373 | 1658663 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 5 | 1718554 | 1718844 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 6 | 982457 | 982747 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 7 | 835740 | 836030 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 8 | 978684 | 978974 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 9 | 1669714 | 1670004 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 10 | 146427 | 146723 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 11 | 1766547 | 1766837 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 12 | 1785322 | 1785612 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 13 | 614510 | 614806 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 14 | 2321893 | 2322186 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 15 | 1658776 | 1659069 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 16 | 1745758 | 1746048 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 17 | 1647752 | 1648042 | + | NZ_CP027770.1 | Staphylococcus felis |
| 18 | 630103 | 630399 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 19 | 1526538 | 1526834 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 20 | 1610011 | 1610307 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 21 | 485056 | 485346 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 22 | 814344 | 814634 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 23 | 1237462 | 1237707 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 24 | 2145386 | 2145682 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 25 | 929446 | 929739 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 26 | 927750 | 928004 | + | NZ_CP047361.1 | Macrococcus canis |
| 27 | 1842436 | 1842675 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 28 | 790810 | 791061 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 29 | 1000030 | 1000323 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 30 | 1685961 | 1686251 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 31 | 1516483 | 1516725 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 32 | 787923 | 788216 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 33 | 208270 | 208536 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 34 | 137167 | 137454 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 35 | 1789681 | 1789953 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 36 | 1998209 | 1998451 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 37 | 2642025 | 2642267 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 38 | 1297705 | 1297947 | + | NZ_CP012024.1 | Bacillus smithii |
| 39 | 1518711 | 1518983 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 40 | 1577863 | 1578135 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 41 | 1584191 | 1584463 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 42 | 374561 | 374833 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 43 | 1611321 | 1611593 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 44 | 2395141 | 2395419 | - | NZ_CP011937.1 | Bacillus velezensis |
| 45 | 1565730 | 1566008 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 46 | 1615399 | 1615671 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 47 | 185901 | 186155 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 48 | 1513263 | 1513544 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 49 | 985047 | 985319 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 50 | 2844956 | 2845195 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 51 | 18897 | 19178 | - | NZ_CP043404.1 | Bacillus safensis |
| 52 | 3969712 | 3969975 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134304.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14450.8 | 0.62 | 32 | 3519.0 | same-strand | Cell division protein FtsA |
| 2 | PF02491.22 | 0.62 | 32 | 3519.0 | same-strand | SHS2 domain inserted in FTSA |
| 3 | PF00091.27 | 0.63 | 33 | 2315 | same-strand | Tubulin/FtsZ family, GTPase domain |
| 4 | PF12327.10 | 0.63 | 33 | 2315 | same-strand | FtsZ family, C-terminal domain |
| 5 | PF02578.17 | 1.0 | 52 | 1264.0 | same-strand | Multi-copper polyphenol oxidoreductase laccase |
| 6 | PF01168.22 | 1.0 | 52 | 580.0 | same-strand | Alanine racemase, N-terminal domain |
| 7 | PF04472.14 | 1.0 | 52 | 12.0 | same-strand | Cell division protein SepF |
| 8 | PF17774.3 | 0.96 | 50 | 74.5 | same-strand | Putative RNA-binding domain in YlmH |
| 9 | PF01479.27 | 0.96 | 50 | 101 | same-strand | S4 domain |
| 10 | PF05103.15 | 0.96 | 50 | 928.5 | same-strand | DivIVA protein |
| 11 | PF00133.24 | 0.96 | 50 | 1765.0 | same-strand | tRNA synthetases class I (I, L, M and V) |
| 12 | PF08264.15 | 0.96 | 50 | 1765.0 | same-strand | Anticodon-binding domain of tRNA ligase |
| 13 | PF06827.16 | 0.73 | 38 | 1812.5 | same-strand | Zinc finger found in FPG and IleRS |
| 14 | PF01252.20 | 0.69 | 36 | 5151.0 | same-strand | Signal peptidase (SPase) II |
++ More..