Result : EXP01617
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01617 |
| NCBI Accession ID | BA000022.2 |
| Organism | Synechocystis sp. PCC 6803 |
| Left | 1135337 |
| Right | 1135588 |
| Strand | + |
| Nucleotide Sequence | ATGTCCATTTATGTCGGGAACCTTTCTTACCAAGCCACCGAAGATGACGTTTTGACTGTCTTCTCCGAGTATGGCACTGTTAAGCGGGTTCAACTTCCCACTGATCGGGAGACCGGTCGTATGCGGGGTTTTGGTTTCGTTGAAATGTCTTCCGATAAGGAAGAAGATGCCGCCATTGAAGCTCTGGATGGAGCCGAATGGATGGGGCGGGATCTCAAAGTTAATAAAGCAAGACCGAGAACCCCTCGTTAA |
| Sequence | MSIYVGNLSYQATEDDVLTVFSEYGTVKRVQLPTDRETGRMRGFGFVEMSSDKEEDAAIEALDGAEWMGRDLKVNKARPRTPR |
| Source of smORF | Protein-level |
| Function | RNA binding [GO:0003723] The ORF matches to the profile of cl17169. Profile Description: RNA recognition motif (RRM) superfamily. Crp79, also called meiotic expression up-regulated protein 5 (Mug5), or polyadenylate-binding protein crp79, or PABP, or poly(A)-binding protein, is an auxiliary mRNA export factor that binds the poly(A) tail of mRNA and is involved in the export of mRNA from the nucleus to the cytoplasm. Mug28 is a meiosis-specific protein that regulates spore wall formation. Members in this family contain three RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains). The model corresponds to the three RRM motif. |
| Pubmed ID | 30796087 |
| Domain | CDD:418427 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | Q9WX37 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 135
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 52530 | 52829 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 2 | 1576477 | 1576725 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 3 | 6759493 | 6759780 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 4 | 3389630 | 3389914 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 5 | 8073349 | 8073648 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 6 | 1561734 | 1562030 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 7 | 930943 | 931221 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 8 | 2792385 | 2792681 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 9 | 2797509 | 2797778 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 10 | 2081263 | 2081550 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 11 | 62512 | 62808 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 12 | 2214129 | 2214413 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 13 | 215663 | 215935 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 14 | 5609853 | 5610113 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 15 | 556808 | 557095 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 16 | 2014474 | 2014722 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 17 | 2656095 | 2656382 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 18 | 2345110 | 2345394 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 19 | 1505782 | 1506054 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 20 | 1737734 | 1738021 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 21 | 4829678 | 4829971 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 22 | 1193300 | 1193590 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 23 | 3169315 | 3169608 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 24 | 1808577 | 1808864 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 25 | 1414466 | 1414711 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 26 | 2601475 | 2601771 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 27 | 4535236 | 4535481 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 28 | 3080033 | 3080332 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 29 | 4045779 | 4046072 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 30 | 4984755 | 4985051 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 31 | 136339 | 136620 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 32 | 3628951 | 3629235 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 33 | 1790798 | 1791088 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 34 | 1996936 | 1997226 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 35 | 35997 | 36242 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 36 | 1810909 | 1811202 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 37 | 1810076 | 1810369 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 38 | 2935188 | 2935484 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 39 | 1482862 | 1483155 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 40 | 54743 | 55012 | - | NC_009926.1 | Acaryochloris marina MBIC11017 |
| 41 | 90919 | 91206 | - | NC_009926.1 | Acaryochloris marina MBIC11017 |
| 42 | 67539 | 67826 | - | NC_009926.1 | Acaryochloris marina MBIC11017 |
| 43 | 1335006 | 1335296 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 44 | 2260721 | 2261008 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 45 | 566 | 853 | + | NC_009929.1 | Acaryochloris marina MBIC11017 |
| 46 | 222611 | 222844 | + | NC_009929.1 | Acaryochloris marina MBIC11017 |
| 47 | 72752 | 73027 | - | NC_009928.1 | Acaryochloris marina MBIC11017 |
| 48 | 53557 | 53802 | - | NC_009928.1 | Acaryochloris marina MBIC11017 |
| 49 | 10409 | 10696 | + | NZ_CP042329.1 | Euhalothece natronophila Z-M001 |
| 50 | 1239096 | 1239350 | + | NC_012115.1 | Nautilia profundicola AmH |
| 51 | 749122 | 749376 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 52 | 1597180 | 1597455 | + | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 53 | 4062492 | 4062776 | + | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 54 | 219183 | 219473 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 55 | 2314915 | 2315166 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 56 | 1346876 | 1347148 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 57 | 2536780 | 2536992 | - | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 58 | 14228 | 14494 | + | NC_020127.1 | Lawsonia intracellularis N343 |
| 59 | 137342 | 137608 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 60 | 718804 | 719067 | + | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 61 | 2573372 | 2573581 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 62 | 1208206 | 1208472 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 63 | 3572235 | 3572480 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 64 | 335656 | 335871 | - | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 65 | 1463897 | 1464160 | - | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 66 | 1394717 | 1394971 | + | NZ_CP027432.2 | Caminibacter pacificus |
| 67 | 1060188 | 1060436 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 68 | 525162 | 525371 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 69 | 1657835 | 1658044 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 70 | 874276 | 874485 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 71 | 1254638 | 1254913 | - | NZ_CP048878.1 | Spartinivicinus ruber |
| 72 | 1363979 | 1364254 | - | NZ_CP048878.1 | Spartinivicinus ruber |
| 73 | 1363184 | 1363459 | + | NZ_CP048878.1 | Spartinivicinus ruber |
| 74 | 1204383 | 1204658 | + | NZ_CP048878.1 | Spartinivicinus ruber |
| 75 | 2409468 | 2409677 | + | NZ_CP039543.1 | Desulfovibrio marinus |
| 76 | 2241083 | 2241346 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 77 | 1929712 | 1929990 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 78 | 977493 | 977771 | + | NZ_CP032101.1 | Malaciobacter marinus |
| 79 | 307147 | 307395 | + | NC_014836.1 | Desulfurispirillum indicum S5 |
| 80 | 120987 | 121211 | + | NC_014836.1 | Desulfurispirillum indicum S5 |
| 81 | 121321 | 121569 | + | NC_014836.1 | Desulfurispirillum indicum S5 |
| 82 | 1007398 | 1007676 | + | NZ_CP042812.1 | Malaciobacter canalis |
| 83 | 2225079 | 2225345 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 84 | 1908007 | 1908252 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 85 | 420370 | 420636 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 86 | 177699 | 177944 | - | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 87 | 2315139 | 2315348 | - | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 88 | 1402871 | 1403146 | - | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 89 | 2018601 | 2018864 | + | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 90 | 1721209 | 1721469 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 91 | 624229 | 624471 | - | NC_015318.1 | Hippea maritima DSM 10411 |
| 92 | 543363 | 543575 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 93 | 455565 | 455843 | + | NC_007645.1 | Hahella chejuensis KCTC 2396 |
| 94 | 2293178 | 2293447 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 95 | 1980185 | 1980463 | - | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 96 | 2720545 | 2720760 | - | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 97 | 878372 | 878629 | - | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 98 | 2403338 | 2403586 | + | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 99 | 4033423 | 4033683 | + | NZ_CP013118.1 | Salinivirga cyanobacteriivorans |
| 100 | 593681 | 593932 | - | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 101 | 1232262 | 1232474 | - | NZ_CP059443.1 | Campylobacter fetus |
| 102 | 1438312 | 1438563 | - | NZ_CP036281.1 | Polystyrenella longa |
| 103 | 3762414 | 3762677 | - | NZ_CP036281.1 | Polystyrenella longa |
| 104 | 3293471 | 3293737 | + | NZ_CP017476.1 | Hydrogenophaga crassostreae |
| 105 | 180017 | 180229 | + | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
| 106 | 2852159 | 2852434 | + | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 107 | 1326481 | 1326765 | - | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 108 | 994998 | 995267 | - | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 109 | 227354 | 227620 | + | NC_021291.1 | Spiribacter salinus M19-40 |
| 110 | 1359192 | 1359404 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
| 111 | 1231015 | 1231269 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 112 | 1230510 | 1230767 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 113 | 1055736 | 1056029 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 114 | 3552824 | 3553123 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 115 | 59810 | 60067 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 116 | 997832 | 998110 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 117 | 911675 | 911953 | + | NZ_CP031218.1 | Malaciobacter halophilus |
| 118 | 8750838 | 8751098 | + | NZ_CP042425.1 | Limnoglobus roseus |
| 119 | 1707937 | 1708200 | - | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 120 | 3423100 | 3423363 | - | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 121 | 2632252 | 2632500 | - | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 122 | 874550 | 874849 | - | NZ_AP017928.1 | Methylocaldum marinum |
| 123 | 3371809 | 3372081 | - | NZ_CP011801.1 | Nitrospira moscoviensis |
| 124 | 1631468 | 1631752 | + | NZ_CP040449.1 | Aeromonas simiae |
| 125 | 1190113 | 1190412 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 126 | 174676 | 174933 | + | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 127 | 3906948 | 3907241 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 128 | 1281741 | 1282019 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 129 | 1859386 | 1859655 | + | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 130 | 170530 | 170796 | + | NZ_CP053836.1 | Halarcobacter ebronensis |
| 131 | 1959578 | 1959856 | + | NZ_CP050851.1 | Aeromonas hydrophila |
| 132 | 4339185 | 4339412 | + | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 133 | 2494547 | 2494828 | - | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 134 | 45777 | 46058 | + | NZ_CP036246.2 | [Arcobacter] porcinus |
| 135 | 5978547 | 5978846 | - | NZ_CP042997.1 | Aquisphaera giovannonii |
| 136 | 3573032 | 3573307 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 137 | 2977159 | 2977422 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 138 | 921691 | 921954 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 139 | 339439 | 339714 | + | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 140 | 3128565 | 3128849 | + | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 141 | 1059680 | 1059940 | - | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 142 | 104286 | 104552 | + | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 143 | 62132 | 62371 | - | NZ_LT828648.1 | Nitrospira japonica |
| 144 | 1039792 | 1040037 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 145 | 47747 | 48028 | + | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 146 | 2116875 | 2117120 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 147 | 320005 | 320250 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 148 | 2414331 | 2414624 | - | NC_018018.1 | Bernardetia litoralis DSM 6794 |
| 149 | 961710 | 961997 | - | NC_018018.1 | Bernardetia litoralis DSM 6794 |
| 150 | 1735082 | 1735321 | - | NZ_AP018724.1 | Sulfurivermis fontis |
| 151 | 1278405 | 1278641 | - | NZ_CP047650.1 | Xylophilus rhododendri |
| 152 | 367928 | 368203 | - | NZ_CP011971.1 | Steroidobacter denitrificans |
| 153 | 461551 | 461778 | + | NZ_CP011971.1 | Steroidobacter denitrificans |
| 154 | 70343 | 70609 | + | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 155 | 1966347 | 1966628 | + | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 156 | 1296801 | 1297052 | - | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 157 | 1402998 | 1403297 | - | NZ_LT906459.1 | Odoribacter splanchnicus |
| 158 | 45723 | 45989 | - | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 159 | 3549927 | 3550196 | - | NC_015578.1 | Treponema primitia ZAS-2 |
| 160 | 462715 | 462960 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 161 | 3580846 | 3581097 | + | NZ_CP038033.1 | Nitrosococcus wardiae |
| 162 | 2908898 | 2909185 | + | NC_015732.1 | Treponema caldarium DSM 7334 |
| 163 | 2956506 | 2956796 | - | NC_015732.1 | Treponema caldarium DSM 7334 |
| 164 | 1558853 | 1559098 | + | NZ_CP027666.1 | Ottowia oryzae |
| 165 | 243601 | 243861 | + | NC_022664.1 | Spiribacter curvatus |
| 166 | 227117 | 227368 | - | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 167 | 2283205 | 2283456 | - | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 168 | 2041274 | 2041519 | - | NC_014734.1 | Paludibacter propionicigenes WB4 |
| 169 | 906459 | 906749 | + | NZ_CP036278.1 | Aeoliella mucimassa |
| 170 | 521718 | 521963 | + | NZ_CP012541.1 | Campylobacter concisus |
| 171 | 1408290 | 1408547 | + | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 172 | 3378738 | 3379025 | + | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 173 | 3142623 | 3142901 | + | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
| 174 | 1127811 | 1128056 | - | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
| 175 | 2572255 | 2572500 | - | NZ_LN877293.1 | Bacteroides fragilis |
| 176 | 4569118 | 4569363 | + | NZ_LN877293.1 | Bacteroides fragilis |
| 177 | 229546 | 229794 | - | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
| 178 | 4076205 | 4076450 | - | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 179 | 2696479 | 2696769 | + | NZ_CP042434.1 | Arachidicoccus ginsenosidivorans |
| 180 | 599561 | 599806 | + | NZ_CP053826.1 | Campylobacter curvus |
| 181 | 4481882 | 4482127 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 182 | 270003 | 270251 | + | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 183 | 191908 | 192177 | + | NZ_AP022826.1 | Nitrosophilus labii |
| 184 | 2468344 | 2468619 | - | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 185 | 564277 | 564498 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 186 | 624992 | 625210 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 187 | 196177 | 196446 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 188 | 716398 | 716619 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 189 | 459704 | 459973 | + | NZ_CP014671.1 | Immundisolibacter cernigliae |
| 190 | 163879 | 164097 | - | NZ_CP014991.1 | Helicobacter himalayensis |
| 191 | 1227851 | 1228138 | - | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 192 | 1313869 | 1314114 | - | NZ_CP053831.1 | Campylobacter mucosalis |
| 193 | 2972105 | 2972383 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 194 | 3110973 | 3111251 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 195 | 9527455 | 9527745 | + | NZ_CP035758.1 | Ktedonosporobacter rubrisoli |
| 196 | 316565 | 316792 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 197 | 388365 | 388637 | - | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 198 | 87121 | 87387 | + | NZ_CP035928.1 | Malaciobacter pacificus |
| 199 | 173442 | 173708 | + | NZ_CP041070.1 | Arcobacter anaerophilus |
| 200 | 59515 | 59793 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 201 | 728247 | 728534 | - | NC_010729.1 | Porphyromonas gingivalis ATCC 33277 |
| 202 | 29275 | 29556 | - | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 203 | 2609344 | 2609628 | - | NZ_CP021023.1 | Sedimentisphaera salicampi |
| 204 | 1430682 | 1430891 | - | NZ_CP014056.2 | Grimontia hollisae |
| 205 | 154856 | 155074 | + | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 206 | 6251013 | 6251246 | - | NZ_CP065050.1 | Streptomyces solisilvae |
| 207 | 2693425 | 2693634 | + | NZ_CP040021.1 | Salinivibrio kushneri |
| 208 | 3289618 | 3289872 | + | NZ_AP014635.1 | Vibrio tritonius |
| 209 | 172750 | 172965 | + | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
++ More..