Result : EXP01607
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01607 |
| NCBI Accession ID | NC_000912.1 |
| Organism | Mycoplasma pneumoniae M129 |
| Left | 751206 |
| Right | 751421 |
| Strand | + |
| Nucleotide Sequence | TTGTTACAATTATTTGATATGGCAAAAAAAGACCAACTTACTTTAAGAGGGCCTTTGTATGGCAACAATCGTTCCCACTCCAAGACTATTACGCGCAGAAAGTGGAATGTTAACCTCCAACCATGCAAGGTCAAAACTGCTGATGGCAAGACCACCAGAATCTTAGTTTCTACCAGAACACTGCGCACCTTAAAGAAACACAACCGCCTCTCTTAG |
| Sequence | LLQLFDMAKKDQLTLRGPLYGNNRSHSKTITRRKWNVNLQPCKVKTADGKTTRILVSTRTLRTLKKHNRLS |
| Source of smORF | Protein-level |
| Function | translation [GO:0006412];ribosome [GO:0005840];structural constituent of ribosome [GO:0003735] The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 30796087 |
| Domain | CDD:412338 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | P75171 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 752002 | 752217 | + | NZ_CP010546.1 | Mycoplasma pneumoniae FH |
| 2 | 533041 | 533235 | + | NC_000908.2 | Mycoplasma genitalium G37 |
| 3 | 946169 | 946369 | + | NZ_CP038013.1 | Spiroplasma gladiatoris |
| 4 | 197649 | 197831 | + | NC_021283.1 | Mycoplasma hyopneumoniae 168-L |
| 5 | 224132 | 224326 | - | NZ_CP024161.1 | Mycoplasma dispar |
| 6 | 1204777 | 1204968 | + | NZ_CP011391.1 | Faecalibaculum rodentium |
| 7 | 1143978 | 1144163 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 8 | 891228 | 891413 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 9 | 705423 | 705614 | + | NZ_LR214950.1 | Mycoplasmopsis gallinacea |
| 10 | 731653 | 731838 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 11 | 718705 | 718896 | + | NZ_CP040825.1 | Mycoplasma nasistruthionis |
| 12 | 756336 | 756527 | - | NZ_LR215039.1 | Mycoplasmopsis columboralis |
| 13 | 1123283 | 1123474 | + | NZ_AP019711.1 | Amedibacterium intestinale |
| 14 | 4200533 | 4200724 | + | NC_015064.1 | Granulicella tundricola MP5ACTX9 |
| 15 | 511901 | 512083 | - | NZ_CP007585.1 | Mycoplasma flocculare ATCC 27399 |
| 16 | 728762 | 728953 | - | NZ_CP011368.1 | Mycoplasmopsis canis |
| 17 | 162619 | 162810 | + | NZ_LS991951.1 | Mycoplasmopsis edwardii |
++ More..