Result : EXP01602
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01602 |
| NCBI Accession ID | BA000022.2 |
| Organism | Synechocystis sp. PCC 6803 |
| Left | 3236874 |
| Right | 3237128 |
| Strand | - |
| Nucleotide Sequence | ATGAGCCTGGATAATGAATCAATCTTGCTAGATCTGCGGGGCACTCCCTGTCCGATTAATTTTGTTCGCACTAAGCTCAAATTGGCCCAGATGGCCCCAGGACAATGCCTGGAAGTCTGGCTAGATGAGGGAGAACCAGTGGAGCAGGTACCCCATAGCTTGGAATTGGAAGGCTATACGGAGCAATCCCTACGAGCACTGGAAGGAGAATCGGCCTATTGTTTAACCATTACCGTTCCGGCGACAGTTCCCTAG |
| Sequence | MSLDNESILLDLRGTPCPINFVRTKLKLAQMAPGQCLEVWLDEGEPVEQVPHSLELEGYTEQSLRALEGESAYCLTITVPATVP |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00436. Profile Description: N/A. Members of this family of hypothetical bacterial proteins have no known function. |
| Pubmed ID | 30796087 |
| Domain | CDD:412376 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 902054 | 902272 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 2 | 4326111 | 4326380 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 3 | 4532875 | 4533096 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 4 | 2060686 | 2060901 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 5 | 1787734 | 1787991 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 6 | 1870301 | 1870531 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 7 | 173630 | 173884 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP021983.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00012.22 | 0.86 | 6 | 1609.5 | same-strand | Hsp70 protein |
| 2 | PF01556.20 | 0.86 | 6 | 22.5 | same-strand | DnaJ C terminal domain |
| 3 | PF00226.33 | 0.86 | 6 | 22.5 | same-strand | DnaJ domain |
| 4 | PF00684.21 | 0.86 | 6 | 22.5 | same-strand | DnaJ central domain |
| 5 | PF03193.18 | 1.0 | 7 | -3 | same-strand | RsgA GTPase |
++ More..