Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01602 |
NCBI Accession ID | BA000022.2 |
Organism | Synechocystis sp. PCC 6803 |
Left | 3236874 |
Right | 3237128 |
Strand | - |
Nucleotide Sequence | ATGAGCCTGGATAATGAATCAATCTTGCTAGATCTGCGGGGCACTCCCTGTCCGATTAATTTTGTTCGCACTAAGCTCAAATTGGCCCAGATGGCCCCAGGACAATGCCTGGAAGTCTGGCTAGATGAGGGAGAACCAGTGGAGCAGGTACCCCATAGCTTGGAATTGGAAGGCTATACGGAGCAATCCCTACGAGCACTGGAAGGAGAATCGGCCTATTGTTTAACCATTACCGTTCCGGCGACAGTTCCCTAG |
Sequence | MSLDNESILLDLRGTPCPINFVRTKLKLAQMAPGQCLEVWLDEGEPVEQVPHSLELEGYTEQSLRALEGESAYCLTITVPATVP |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl00436. Profile Description: N/A. Members of this family of hypothetical bacterial proteins have no known function. |
Pubmed ID | 30796087 |
Domain | CDD:412376 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 84 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 902054 | 902272 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
2 | 4326111 | 4326380 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
3 | 4532875 | 4533096 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
4 | 2060686 | 2060901 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
5 | 1787734 | 1787991 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
6 | 1870301 | 1870531 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
7 | 173630 | 173884 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00012.22 | 0.86 | 6 | 1609.5 | same-strand | Hsp70 protein |
2 | PF01556.20 | 0.86 | 6 | 22.5 | same-strand | DnaJ C terminal domain |
3 | PF00226.33 | 0.86 | 6 | 22.5 | same-strand | DnaJ domain |
4 | PF00684.21 | 0.86 | 6 | 22.5 | same-strand | DnaJ central domain |
5 | PF03193.18 | 1.0 | 7 | -3 | same-strand | RsgA GTPase |