Result : EXP01593
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01593 |
| NCBI Accession ID | BA000022.2 |
| Organism | Synechocystis sp. PCC 6803 |
| Left | 1783442 |
| Right | 1783672 |
| Strand | - |
| Nucleotide Sequence | ATGAATGACAATACCACCGCCTCGCTTCGGGACTCTGAAAAAATAGAAGTTTCCATTCAGTTGGACTCGGATCTAATGGATCAAATTCAGCATTTGACCAATGAGCCAAATCGGGTAATTGAAATGGCTGTGAAGCAGTGGCTACGGGGTGAAAAACAACGGGACGATGAGCTAACCCGCAATTTACGCCGCAATCCCCCTGTTCCTCCCCGGGGAGAGTGGAACGACTAA |
| Sequence | MNDNTTASLRDSEKIEVSIQLDSDLMDQIQHLTNEPNRVIEMAVKQWLRGEKQRDDELTRNLRRNPPVPPRGEWND |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 20
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1225404 | 1225634 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 2 | 3659040 | 3659270 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 3 | 3691735 | 3691965 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 4 | 530574 | 530804 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 5 | 3761820 | 3762050 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 6 | 33646 | 33876 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 7 | 772427 | 772654 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 8 | 1109227 | 1109457 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 9 | 81655 | 81882 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 10 | 3235685 | 3235870 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 11 | 5068132 | 5068362 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 12 | 287634 | 287864 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 13 | 2845889 | 2846119 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 14 | 1912877 | 1913107 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 15 | 5113130 | 5113360 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 16 | 5499861 | 5500091 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 17 | 2860914 | 2861144 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 18 | 3753702 | 3753911 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 19 | 3512369 | 3512599 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 20 | 3290165 | 3290389 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_019693.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02518.28 | 0.85 | 17 | 196 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 2 | PF00512.27 | 0.85 | 17 | 198.0 | same-strand | His Kinase A (phospho-acceptor) domain |
| 3 | PF00009.29 | 0.95 | 19 | 366.5 | opposite-strand | Elongation factor Tu GTP binding domain |
| 4 | PF06421.14 | 0.95 | 19 | 362 | opposite-strand | GTP-binding protein LepA C-terminus |
| 5 | PF00679.26 | 0.95 | 19 | 366.5 | opposite-strand | Elongation factor G C-terminus |
| 6 | PF03144.27 | 0.95 | 19 | 366.5 | opposite-strand | Elongation factor Tu domain 2 |
| 7 | PF14492.8 | 0.85 | 17 | 334 | opposite-strand | Elongation Factor G, domain III |
| 8 | PF01926.25 | 0.95 | 19 | 387.0 | opposite-strand | 50S ribosome-binding GTPase |
| 9 | PF13492.8 | 0.85 | 17 | 198.0 | same-strand | GAF domain |
| 10 | PF01590.28 | 0.8 | 16 | 233.5 | same-strand | GAF domain |
| 11 | PF01106.19 | 0.6 | 12 | 2484.0 | same-strand | NifU-like domain |
++ More..