Result : EXP01572
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01572 |
| NCBI Accession ID | NC_017381.1 |
| Organism | Helicobacter pylori 2018 |
| Left | 1229691 |
| Right | 1229921 |
| Strand | + |
| Nucleotide Sequence | ATGTTCCATGAATTTAGAGACGAAATCAGCGTGTTAAAAGCGAATAATCCGCATTTTGATAAGATTTTTGAGAAACACAACCAGCTTGATGCCGACATCAAAACCGCTGAGCAACAAAACGCTAGCGACGCTGAAGTCAGCCACATGAAAAAACAAAAATTAAAATTAAAAGATGAAATCCACAGCATGATTATAGAATATAGAGAAAAGCAAAAATCCGATCATGTTTAA |
| Sequence | MFHEFRDEISVLKANNPHFDKIFEKHNQLDADIKTAEQQNASDAEVSHMKKQKLKLKDEIHSMIIEYREKQKSDHV |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl01070. Profile Description: Protein of unknown function (DUF465). hypothetical protein; Provisional |
| Pubmed ID | 30796087 |
| Domain | CDD:412724 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | P0ACW6 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 50
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1306001 | 1306231 | + | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 111819 | 112049 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 3 | 699299 | 699529 | + | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 4 | 1762018 | 1762245 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 5 | 1902092 | 1902313 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 6 | 136180 | 136404 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 7 | 1252803 | 1253024 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 8 | 914672 | 914896 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 9 | 133271 | 133489 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 10 | 722448 | 722663 | + | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 11 | 2035973 | 2036200 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 12 | 2008080 | 2008307 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 13 | 2161015 | 2161242 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 14 | 4359917 | 4360126 | + | NZ_CP020472.1 | Shewanella japonica |
| 15 | 905927 | 906139 | + | NZ_CP028926.1 | Pasteurella multocida |
| 16 | 4208784 | 4209011 | + | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 17 | 855184 | 855399 | + | NZ_CP035946.1 | Campylobacter canadensis |
| 18 | 358316 | 358543 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 19 | 2619191 | 2619400 | + | NZ_CP041783.1 | Shewanella donghaensis |
| 20 | 4935175 | 4935390 | + | NC_011566.1 | Shewanella piezotolerans WP3 |
| 21 | 4040611 | 4040826 | + | NC_009092.1 | Shewanella loihica PV-4 |
| 22 | 1821070 | 1821294 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 23 | 1498651 | 1498875 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 24 | 2016297 | 2016521 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 25 | 567896 | 568111 | - | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 26 | 2053042 | 2053257 | - | NZ_CP053833.1 | Arcobacter cloacae |
| 27 | 289142 | 289366 | - | NZ_CP063164.1 | Sulfurovum indicum |
| 28 | 1673313 | 1673528 | - | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 29 | 1943152 | 1943367 | - | NZ_CP030944.1 | Arcobacter aquimarinus |
| 30 | 2067002 | 2067217 | - | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 31 | 1991110 | 1991322 | - | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 32 | 2339561 | 2339770 | - | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 33 | 2152997 | 2153212 | - | NZ_CP032097.1 | Arcobacter ellisii |
| 34 | 1735439 | 1735654 | - | NZ_CP035928.1 | Malaciobacter pacificus |
| 35 | 827779 | 828006 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 36 | 2476508 | 2476723 | - | NZ_CP053840.1 | Arcobacter venerupis |
| 37 | 1650058 | 1650285 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 38 | 1812411 | 1812638 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 39 | 1912476 | 1912691 | - | NZ_CP031218.1 | Malaciobacter halophilus |
| 40 | 167854 | 168078 | - | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 41 | 1626398 | 1626625 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 42 | 1934222 | 1934431 | - | NZ_CP029822.1 | Entomomonas moraniae |
| 43 | 2328151 | 2328366 | - | NZ_CP043473.1 | Chromobacterium paludis |
| 44 | 2002779 | 2002994 | + | NZ_CP051883.1 | Aeromonas salmonicida |
| 45 | 1641090 | 1641305 | + | NZ_CP044060.1 | Aeromonas veronii |
| 46 | 1928190 | 1928405 | + | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 47 | 1409145 | 1409360 | - | NZ_LR134376.1 | Aeromonas encheleia |
| 48 | 3265424 | 3265639 | + | NZ_AP022188.1 | Aeromonas media |
| 49 | 1957367 | 1957579 | - | NZ_CP042812.1 | Malaciobacter canalis |
| 50 | 1619522 | 1619737 | - | NZ_CP050851.1 | Aeromonas hydrophila |
| 51 | 1947160 | 1947372 | - | NZ_CP032101.1 | Malaciobacter marinus |
++ More..