Result : EXP01566
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01566 |
| NCBI Accession ID | NC_000908.2 |
| Organism | Mycoplasma genitalium G37 |
| Left | 549905 |
| Right | 550192 |
| Strand | - |
| Nucleotide Sequence | TTGGTCAAAATAAGATTGATGCGGATGGGAAGAGTACACTATCCGCTTTATAGAATAGTAGCGGTTGATTCGCGAGTAAAGCGTAATGGAAAGTATATCGCTTTAATTGGACATCTAAATCCAGCTTTAAAGGAAAATAAGTGTAAATTAGATGAAACTGTTGCCTTAGATTGACTTAATAAAGGGGCAATTCCAACTGATACAGTCCGTTCTTTATTTAGTGAATCTGGTTTGTGGAAGAAATTTATTGAAAGTAAAAATAAGAAAGAAACAAGTCCTAAAAAGTAG |
| Sequence | LVKIRLMRMGRVHYPLYRIVAVDSRVKRNGKYIALIGHLNPALKENKCKLDETVALDWLNKGAIPTDTVRSLFSESGLWKKFIESKNKKETSPKK |
| Source of smORF | Protein-level |
| Function | translation [GO:0006412];small ribosomal subunit [GO:0015935];structural constituent of ribosome [GO:0003735] The ORF matches to the profile of cl00368. Profile Description: Ribosomal protein S16. This model describes ribosomal S16 of bacteria and organelles. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 30796087 |
| Domain | CDD:412339 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | P47684 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 136
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2090956 | 2091207 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 2 | 2084364 | 2084597 | + | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 3 | 1691720 | 1691965 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 4 | 1794622 | 1794867 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 5 | 3907137 | 3907388 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 6 | 1577708 | 1577953 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 7 | 257403 | 257654 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 8 | 2093043 | 2093285 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 9 | 1276617 | 1276862 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 10 | 424112 | 424444 | - | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 11 | 3267210 | 3267455 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 12 | 3988732 | 3988977 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 13 | 2569073 | 2569318 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 14 | 1459617 | 1459862 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 15 | 428052 | 428297 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 16 | 114192 | 114446 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 17 | 2165528 | 2165794 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 18 | 1581329 | 1581574 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 19 | 1604715 | 1604963 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 20 | 1801619 | 1801864 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 21 | 1800980 | 1801225 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 22 | 1764120 | 1764365 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 23 | 959899 | 960144 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 24 | 2616832 | 2617071 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 25 | 1852009 | 1852254 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 26 | 1677767 | 1678012 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 27 | 1641447 | 1641692 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 28 | 1646518 | 1646763 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 29 | 312234 | 312479 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 30 | 1673647 | 1673892 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 31 | 1779009 | 1779254 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 32 | 1425270 | 1425515 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 33 | 4232745 | 4232990 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 34 | 551905 | 552147 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 35 | 774413 | 774658 | + | NC_012924.1 | Streptococcus suis SC84 |
| 36 | 4813118 | 4813363 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 37 | 985556 | 985828 | + | NZ_CP013213.1 | Erysipelothrix larvae |
| 38 | 124028 | 124273 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 39 | 1575194 | 1575439 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 40 | 3743746 | 3743991 | - | NZ_CP043404.1 | Bacillus safensis |
| 41 | 1062462 | 1062707 | - | NZ_LS483343.1 | Streptococcus ferus |
| 42 | 1478145 | 1478390 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 43 | 2486767 | 2487012 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 44 | 1506548 | 1506793 | - | NZ_LR134275.1 | Streptococcus vestibularis |
| 45 | 1609149 | 1609394 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 46 | 1086292 | 1086537 | - | NZ_AP018400.1 | Streptococcus ruminantium |
| 47 | 956778 | 957023 | - | NZ_CP029476.1 | Lactobacillus apis |
| 48 | 1040747 | 1040992 | - | NZ_CP017326.1 | Weissella soli |
| 49 | 1965693 | 1965941 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 50 | 2421074 | 2421316 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 51 | 1281837 | 1282082 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 52 | 2183818 | 2184063 | - | NZ_CP054015.1 | Streptococcus gallolyticus |
| 53 | 1543246 | 1543515 | - | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 54 | 2600807 | 2601052 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 55 | 894199 | 894444 | + | NZ_CP012805.1 | Streptococcus anginosus |
| 56 | 854831 | 855076 | + | NZ_CP034543.1 | Streptococcus periodonticum |
| 57 | 1659230 | 1659475 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 58 | 1041375 | 1041620 | - | NZ_LS483403.1 | Streptococcus lutetiensis |
| 59 | 1206135 | 1206380 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 60 | 2411312 | 2411557 | - | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 61 | 1024628 | 1024873 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 62 | 2586248 | 2586493 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 63 | 854051 | 854296 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 64 | 582889 | 583134 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 65 | 265238 | 265483 | + | NZ_CP014835.1 | Streptococcus halotolerans |
| 66 | 2332271 | 2332516 | - | NZ_CP011937.1 | Bacillus velezensis |
| 67 | 1628630 | 1628875 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 68 | 654008 | 654253 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 69 | 1421220 | 1421465 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 70 | 1562587 | 1562832 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 71 | 2341193 | 2341438 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 72 | 1467169 | 1467414 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 73 | 1185721 | 1185966 | - | NZ_CP029491.1 | Streptococcus sobrinus |
| 74 | 1492753 | 1492998 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 75 | 1857095 | 1857343 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 76 | 1276054 | 1276296 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 77 | 1602146 | 1602394 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 78 | 1984689 | 1984955 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 79 | 1531114 | 1531362 | + | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 80 | 793104 | 793379 | + | NC_016751.1 | Marinitoga piezophila KA3 |
| 81 | 679720 | 679965 | + | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 82 | 1268240 | 1268527 | - | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 83 | 1244875 | 1245162 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 84 | 1258693 | 1258980 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 85 | 2012141 | 2012386 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 86 | 3397907 | 3398152 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 87 | 1789139 | 1789384 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 88 | 2540574 | 2540819 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 89 | 34052 | 34288 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 90 | 617995 | 618240 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 91 | 1091052 | 1091303 | - | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 92 | 1195850 | 1196095 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 93 | 1501319 | 1501564 | + | NZ_CP040336.1 | Bacillus luti |
| 94 | 3658378 | 3658623 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 95 | 3727923 | 3728168 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 96 | 3862973 | 3863218 | - | NC_011725.1 | Bacillus cereus B4264 |
| 97 | 3867215 | 3867460 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 98 | 1108392 | 1108637 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 99 | 1444643 | 1444888 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
| 100 | 573155 | 573400 | - | NZ_CP014163.1 | Aerococcus urinaehominis |
| 101 | 1218076 | 1218342 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 102 | 1949917 | 1950162 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 103 | 1117177 | 1117464 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 104 | 1972468 | 1972713 | - | NZ_CP016538.2 | Planococcus maritimus |
| 105 | 1995711 | 1995956 | - | NZ_CP059540.1 | Planococcus maritimus |
| 106 | 1768142 | 1768387 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 107 | 1101243 | 1101488 | - | NZ_LR594050.1 | Streptococcus porcinus |
| 108 | 370838 | 371077 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 109 | 724650 | 724910 | + | NZ_CP013988.1 | Aerococcus urinaeequi |
| 110 | 1038638 | 1038886 | - | NZ_LT906439.1 | Streptococcus merionis |
| 111 | 1219096 | 1219341 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 112 | 304954 | 305199 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 113 | 666948 | 667193 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 114 | 1451801 | 1452061 | - | NZ_CP014164.1 | Aerococcus viridans |
| 115 | 1117729 | 1117959 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 116 | 2151016 | 2151261 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 117 | 6105373 | 6105618 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 118 | 2763568 | 2763813 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 119 | 1270074 | 1270346 | - | NZ_CP046314.1 | Gemella morbillorum |
| 120 | 932232 | 932504 | + | NZ_LR134484.1 | Gemella haemolysans |
| 121 | 2789376 | 2789621 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 122 | 1431576 | 1431821 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 123 | 1802554 | 1802799 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 124 | 1039972 | 1040217 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 125 | 1007644 | 1007892 | + | NZ_CP047361.1 | Macrococcus canis |
| 126 | 970950 | 971201 | - | NZ_CP019573.1 | Abyssicoccus albus |
| 127 | 2595308 | 2595553 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 128 | 428129 | 428383 | + | NZ_CP031513.1 | Bombilactobacillus bombi |
| 129 | 3737518 | 3737763 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 130 | 4068091 | 4068336 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 131 | 1103512 | 1103760 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 132 | 1537934 | 1538209 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 133 | 691678 | 691953 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 134 | 1460327 | 1460602 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 135 | 712951 | 713199 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 136 | 2250791 | 2251033 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 137 | 1219060 | 1219320 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP029797.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01245.22 | 0.74 | 101 | 2084.0 | same-strand | Ribosomal protein L19 |
| 2 | PF01746.23 | 0.89 | 121 | 1169.5 | same-strand | tRNA (Guanine-1)-methyltransferase |
| 3 | PF01782.20 | 0.89 | 121 | 659 | same-strand | RimM N-terminal domain |
| 4 | PF05239.18 | 0.87 | 118 | 679 | same-strand | PRC-barrel domain |
| 5 | PF13083.8 | 0.91 | 124 | 15 | same-strand | KH domain |
| 6 | PF00448.24 | 0.79 | 108 | 179.5 | same-strand | SRP54-type protein, GTPase domain |
| 7 | PF02978.21 | 0.79 | 108 | 122 | same-strand | Signal peptide binding domain |
| 8 | PF02881.21 | 0.79 | 108 | 179.5 | same-strand | SRP54-type protein, helical bundle domain |
| 9 | PF04297.16 | 0.7 | 95 | 1491.0 | same-strand | Putative helix-turn-helix protein, YlxM / p13 like |
++ More..