Result : EXP01556
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01556 |
| NCBI Accession ID | BA000022.2 |
| Organism | Synechocystis sp. PCC 6803 |
| Left | 318661 |
| Right | 318897 |
| Strand | + |
| Nucleotide Sequence | ATGGCCCGTCGCTGTCAACTGACCGGGAAAAAAGCTAATAACGGTTTTGCCGTATCTCACTCCCACCGTCGCACCAAGAAATTACAACAGGCAAATTTGCAATGGAAACGGGTTTGGTGGCCCGAAGGCAATCGCTTTGTCCGTCTGCGTCTTTCCACCACTGCCATTAAAACTTTGGAATCCAAAGGCATCAACGCCATGGCCAAGGAAGCGGGCATCAACTTGAATAAATTCTAG |
| Sequence | MARRCQLTGKKANNGFAVSHSHRRTKKLQQANLQWKRVWWPEGNRFVRLRLSTTAIKTLESKGINAMAKEAGINLNKF |
| Source of smORF | Protein-level |
| Function | translation [GO:0006412];ribosome [GO:0005840];structural constituent of ribosome [GO:0003735] The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 30796087 |
| Domain | CDD:412338 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | Q3AJS3 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 75
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2056241 | 2056477 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 2 | 3103818 | 3104054 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 3 | 981958 | 982194 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 4 | 2553959 | 2554195 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 5 | 2576546 | 2576782 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 6 | 1481508 | 1481744 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 7 | 1943062 | 1943298 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 8 | 1936427 | 1936663 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 9 | 5096461 | 5096697 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 10 | 2033125 | 2033361 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 11 | 3172184 | 3172420 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 12 | 3627669 | 3627917 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 13 | 1319266 | 1319502 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 14 | 3525408 | 3525644 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 15 | 1027946 | 1028182 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 16 | 1679515 | 1679751 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 17 | 4706129 | 4706365 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 18 | 2727967 | 2728203 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 19 | 1250703 | 1250939 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 20 | 582324 | 582560 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 21 | 3686248 | 3686484 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 22 | 2784672 | 2784908 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 23 | 4514647 | 4514883 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 24 | 2921224 | 2921460 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 25 | 4987001 | 4987237 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 26 | 121297 | 121533 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 27 | 641238 | 641474 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 28 | 2661297 | 2661542 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 29 | 4045212 | 4045457 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 30 | 561455 | 561691 | + | NC_016025.1 | Chloracidobacterium thermophilum B |
| 31 | 511825 | 512061 | - | NC_016025.1 | Chloracidobacterium thermophilum B |
| 32 | 847533 | 847769 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 33 | 667984 | 668223 | - | NC_017464.1 | Ignavibacterium album JCM 16511 |
| 34 | 679017 | 679253 | - | NZ_CP022386.1 | Capnocytophaga gingivalis |
| 35 | 4917492 | 4917728 | + | NZ_CP019288.1 | Kordia antarctica |
| 36 | 3636658 | 3636894 | - | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 37 | 3418753 | 3418989 | + | NZ_AP021884.1 | Sulfuriferula plumbiphila |
| 38 | 678615 | 678851 | - | NZ_LT906449.1 | Capnocytophaga haemolytica |
| 39 | 2556803 | 2557039 | + | NC_013162.1 | Capnocytophaga ochracea DSM 7271 |
| 40 | 7587970 | 7588206 | - | NZ_CP023692.1 | Streptomyces vinaceus |
| 41 | 748106 | 748348 | + | NC_008255.1 | Cytophaga hutchinsonii ATCC 33406 |
| 42 | 4426005 | 4426241 | + | NZ_CP022521.1 | Actinoalloteichus hoggarensis |
| 43 | 1847365 | 1847601 | + | NZ_CP053352.1 | Winogradskyella helgolandensis |
| 44 | 2887331 | 2887570 | + | NZ_CP016359.1 | Gramella flava JLT2011 |
| 45 | 7271610 | 7271846 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 46 | 631373 | 631606 | + | NZ_CP022387.1 | Capnocytophaga stomatis |
| 47 | 951862 | 952098 | - | NZ_CP060404.1 | Streptomyces buecherae |
| 48 | 6671093 | 6671329 | + | NZ_CP029254.1 | Streptomyces spongiicola |
| 49 | 7129588 | 7129824 | - | NZ_CP010407.1 | Streptomyces vietnamensis |
| 50 | 1006829 | 1007059 | - | NC_016620.1 | Halobacteriovorax marinus SJ |
| 51 | 784768 | 785001 | - | NZ_CP022389.1 | Capnocytophaga canimorsus |
| 52 | 2191802 | 2192032 | + | NZ_CP016793.1 | Lentzea guizhouensis |
| 53 | 5758499 | 5758735 | + | NZ_CP031142.1 | Saccharopolyspora pogona |
| 54 | 6431785 | 6432021 | + | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 55 | 1748633 | 1748869 | + | NZ_CP065050.1 | Streptomyces solisilvae |
| 56 | 7323109 | 7323345 | + | NZ_CP024957.1 | Streptomyces cavourensis |
| 57 | 2717601 | 2717837 | - | NZ_CP030862.1 | Streptomyces globosus |
| 58 | 579245 | 579481 | - | NZ_CP039456.1 | Changchengzhania lutea |
| 59 | 1726117 | 1726353 | - | NZ_CP023698.1 | Streptomyces viridifaciens |
| 60 | 629849 | 630085 | - | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 61 | 545716 | 545952 | - | NZ_CP022987.1 | Pusillimonas thiosulfatoxidans |
| 62 | 7696758 | 7696994 | + | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 63 | 6952631 | 6952867 | - | NZ_CP029196.1 | Streptomyces venezuelae |
| 64 | 30895 | 31128 | + | NZ_LR590470.1 | Sphingobacterium daejeonense |
| 65 | 819732 | 819965 | + | NZ_CP049246.1 | Sphingobacterium lactis |
| 66 | 30590 | 30823 | + | NZ_CP030848.1 | Sphingobacterium hotanense |
| 67 | 487399 | 487635 | - | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 68 | 5082222 | 5082458 | - | NZ_CP015098.1 | Streptomyces qaidamensis |
| 69 | 7512366 | 7512602 | + | NZ_CP070242.1 | Streptomyces californicus |
| 70 | 7557241 | 7557477 | + | NZ_CP020570.1 | Streptomyces violaceoruber |
| 71 | 4807185 | 4807421 | - | NZ_CP051486.1 | Streptomyces pratensis |
| 72 | 4370203 | 4370439 | - | NZ_CP023695.1 | Streptomyces alboniger |
| 73 | 7837401 | 7837637 | + | NZ_CP020563.1 | Kitasatospora albolonga |
| 74 | 1736354 | 1736587 | - | NZ_LR590484.1 | Sphingobacterium thalpophilum |
| 75 | 2400942 | 2401172 | + | NZ_CP053564.1 | Pseudonocardia broussonetiae |
| 76 | 4928287 | 4928523 | + | NZ_CP045572.1 | Nonomuraea nitratireducens |
++ More..