Result : EXP01555
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01555 |
| NCBI Accession ID | NC_017381.1 |
| Organism | Helicobacter pylori 2018 |
| Left | 1012784 |
| Right | 1013068 |
| Strand | - |
| Nucleotide Sequence | GTGGGGCTTATTAAAGAAGCTCAAAGGATTGAAAAATCCAATAAATTACTGCGCTTAAAAGTGGATTTAGGCGAAAATCGTTTGAGGCAGATCATCTCAGGGATCGCTTTGGATTATGAGCCTGAAAGTTTGGTGGGGCAAATGGTGTGCGTGGTGGCTAATTTAAAACCCGCCAAGCTCATGGGCGAAATGAGTGAGGGCATGATTTTAGCGGTGCGAGATAGCGATAATCTGGCTTTAATCAGCCCTACCAAAGAAAAAATTGCAGGAAGTTTGATCAGTTAA |
| Sequence | VGLIKEAQRIEKSNKLLRLKVDLGENRLRQIISGIALDYEPESLVGQMVCVVANLKPAKLMGEMSEGMILAVRDSDNLALISPTKEKIAGSLIS |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00320. Profile Description: N/A. This domain is found in prokaryotic methionyl-tRNA synthetases, prokaryotic phenylalanyl tRNA synthetases the yeast GU4 nucleic-binding protein (G4p1 or p42, ARC1), human tyrosyl-tRNA synthetase, and endothelial-monocyte activating polypeptide II. G4p1 binds specifically to tRNA form a complex with methionyl-tRNA synthetases. In human tyrosyl-tRNA synthetase this domain may direct tRNA to the active site of the enzyme. This domain may perform a common function in tRNA aminoacylation. |
| Pubmed ID | 30796087 |
| Domain | CDD:412307 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 176
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1075933 | 1076217 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 533569 | 533853 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 3 | 692390 | 692620 | - | NZ_AP022847.1 | Nitrosophilus alvini |
| 4 | 227765 | 228001 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 5 | 1131241 | 1131543 | + | NZ_CP063087.1 | Helicobacter winghamensis |
| 6 | 1543417 | 1543701 | - | NZ_LS483446.1 | Helicobacter mustelae |
| 7 | 1573827 | 1574084 | - | NZ_CP021886.1 | Helicobacter apodemus |
| 8 | 528641 | 528925 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 9 | 1346261 | 1346545 | + | NZ_CP054051.1 | Aliarcobacter cibarius |
| 10 | 214333 | 214629 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 11 | 767833 | 768102 | + | NZ_CP027432.2 | Caminibacter pacificus |
| 12 | 1340778 | 1341053 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 13 | 1437143 | 1437400 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 14 | 1144776 | 1145045 | - | NC_012115.1 | Nautilia profundicola AmH |
| 15 | 1667820 | 1668092 | - | NZ_CP012543.1 | Campylobacter rectus |
| 16 | 187113 | 187382 | - | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 17 | 4541052 | 4541309 | - | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 18 | 2194466 | 2194741 | + | NZ_LS974202.1 | Mesotoga infera |
| 19 | 1079172 | 1079429 | - | NZ_CP063164.1 | Sulfurovum indicum |
| 20 | 1968362 | 1968634 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 21 | 681516 | 681752 | + | NZ_CP012544.1 | Campylobacter showae |
| 22 | 432271 | 432528 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 23 | 1094087 | 1094320 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 24 | 3062267 | 3062542 | + | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 25 | 666217 | 666549 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 26 | 854413 | 854697 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 27 | 198250 | 198543 | - | NC_014002.1 | Methanohalophilus mahii DSM 5219 |
| 28 | 890517 | 890801 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 29 | 1063280 | 1063510 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 30 | 1055703 | 1055933 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 31 | 1324817 | 1325095 | - | NC_010003.1 | Petrotoga mobilis SJ95 |
| 32 | 1145653 | 1145889 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
| 33 | 1276948 | 1277187 | - | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 34 | 1034313 | 1034546 | + | NZ_CP012196.1 | Campylobacter gracilis |
| 35 | 104093 | 104386 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 36 | 522422 | 522715 | + | NZ_CP017921.1 | Methanohalophilus halophilus |
| 37 | 814881 | 815171 | + | NZ_CP059443.1 | Campylobacter fetus |
| 38 | 244085 | 244318 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 39 | 1475315 | 1475602 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 40 | 1735555 | 1735833 | + | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 41 | 708330 | 708611 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 42 | 1810775 | 1811005 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 43 | 1533995 | 1534273 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 44 | 969310 | 969543 | + | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 45 | 1276010 | 1276246 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 46 | 929531 | 929788 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 47 | 331744 | 331977 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 48 | 1205458 | 1205694 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 49 | 1165382 | 1165669 | + | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 50 | 525676 | 526014 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 51 | 1655747 | 1656067 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 52 | 2040407 | 2040694 | - | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 53 | 38580 | 38810 | + | NC_013156.1 | Methanocaldococcus fervens AG86 |
| 54 | 461683 | 462012 | - | NZ_CP009149.1 | Methanocaldococcus bathoardescens |
| 55 | 260540 | 260827 | + | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 56 | 1676625 | 1676945 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 57 | 267342 | 267668 | - | NC_015315.1 | Thermoproteus uzoniensis 768-20 |
| 58 | 473539 | 473796 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 59 | 359066 | 359398 | - | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 60 | 364583 | 364915 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 61 | 172401 | 172634 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 62 | 49648 | 49917 | + | NZ_CP024955.1 | Kyrpidia spormannii |
| 63 | 1207287 | 1207616 | + | NC_000909.1 | Methanocaldococcus jannaschii DSM 2661 |
| 64 | 2600641 | 2600928 | + | NZ_CP013195.1 | Prevotella enoeca |
| 65 | 264047 | 264304 | + | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 66 | 3064052 | 3064348 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 67 | 49169 | 49438 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 68 | 992941 | 993198 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 69 | 192723 | 192992 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 70 | 789143 | 789433 | + | NC_013407.1 | Methanocaldococcus vulcanius M7 |
| 71 | 27499 | 27780 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 72 | 214816 | 215073 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 73 | 69217 | 69537 | - | NC_009515.1 | Methanobrevibacter smithii ATCC 35061 |
| 74 | 152760 | 153044 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 75 | 3720545 | 3720784 | + | NZ_CP012938.1 | Bacteroides ovatus |
| 76 | 154020 | 154277 | + | NZ_LT906444.1 | Listeria welshimeri |
| 77 | 4148474 | 4148713 | + | NZ_CP015401.2 | Bacteroides caecimuris |
| 78 | 958119 | 958397 | - | NC_011295.1 | Coprothermobacter proteolyticus DSM 5265 |
| 79 | 963549 | 963827 | - | NC_008553.1 | Methanothrix thermoacetophila PT |
| 80 | 71072 | 71305 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 81 | 2095735 | 2095968 | - | NZ_CP010904.1 | Kiritimatiella glycovorans |
| 82 | 2453048 | 2453302 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 83 | 2283691 | 2283924 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 84 | 1677242 | 1677514 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 85 | 1443984 | 1444217 | + | NZ_CP030032.1 | Bradymonas sediminis |
| 86 | 2252079 | 2252351 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 87 | 926961 | 927242 | - | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 88 | 69101 | 69382 | + | NZ_CP034118.1 | Staphylospora marina |
| 89 | 273258 | 273491 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 90 | 935399 | 935683 | - | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 91 | 2504070 | 2504324 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 92 | 2730149 | 2730430 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 93 | 2341823 | 2342056 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 94 | 1836155 | 1836436 | + | NC_014507.1 | Methanolacinia petrolearia DSM 11571 |
| 95 | 3847521 | 3847754 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 96 | 154528 | 154815 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 97 | 82037 | 82270 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 98 | 610791 | 611105 | + | NZ_CP014265.1 | Methanobrevibacter olleyae |
| 99 | 1625824 | 1626078 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 100 | 177503 | 177760 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 101 | 3298345 | 3298641 | - | NZ_CP020105.1 | Spirosoma rigui |
| 102 | 174532 | 174768 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 103 | 2470414 | 2470650 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 104 | 107849 | 108124 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 105 | 1223831 | 1224112 | + | NC_013790.1 | Methanobrevibacter ruminantium M1 |
| 106 | 1958207 | 1958461 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 107 | 295223 | 295459 | - | NC_015703.1 | Runella slithyformis DSM 19594 |
| 108 | 2492149 | 2492436 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 109 | 501460 | 501744 | + | NC_017464.1 | Ignavibacterium album JCM 16511 |
| 110 | 2326407 | 2326661 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 111 | 539840 | 540079 | - | NZ_CP053831.1 | Campylobacter mucosalis |
| 112 | 2458582 | 2458836 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 113 | 595882 | 596142 | - | NC_014836.1 | Desulfurispirillum indicum S5 |
| 114 | 4657933 | 4658187 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 115 | 142014 | 142295 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 116 | 657275 | 657574 | - | NZ_CP053187.1 | Turicibacter sanguinis |
| 117 | 1079368 | 1079616 | - | NZ_AP018449.1 | Methylomusa anaerophila |
| 118 | 3999315 | 3999614 | + | NZ_LT828648.1 | Nitrospira japonica |
| 119 | 889961 | 890233 | - | NC_014961.1 | Desulfurococcus mucosus DSM 2162 |
| 120 | 911572 | 911844 | + | NC_014408.1 | Methanothermobacter marburgensis str. Marburg |
| 121 | 1080229 | 1080510 | + | NC_009073.1 | Pyrobaculum calidifontis JCM 11548 |
| 122 | 2172054 | 2172290 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 123 | 142156 | 142425 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 124 | 692419 | 692700 | - | NC_011832.1 | Methanosphaerula palustris E1-9c |
| 125 | 1688985 | 1689239 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 126 | 946034 | 946270 | - | NC_018001.1 | Desulfurococcus amylolyticus DSM 16532 |
| 127 | 2294106 | 2294339 | - | NZ_CP047361.1 | Macrococcus canis |
| 128 | 453567 | 453851 | + | NZ_CP022464.2 | Enterocloster bolteae |
| 129 | 510941 | 511174 | - | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
| 130 | 5054817 | 5055092 | + | NZ_CP036259.1 | Sporomusa termitida |
| 131 | 581196 | 581483 | - | NC_016070.1 | Thermoproteus tenax Kra 1 |
| 132 | 183073 | 183366 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 133 | 527636 | 527902 | + | NC_000916.1 | Methanothermobacter thermautotrophicus str. Delta H |
| 134 | 78438 | 78719 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 135 | 1671999 | 1672292 | - | NC_015562.1 | Methanotorris igneus Kol 5 |
| 136 | 3838810 | 3839088 | - | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 137 | 51818 | 52099 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 138 | 1575476 | 1575715 | - | NZ_CP061835.1 | Weissella viridescens |
| 139 | 3470857 | 3471132 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 140 | 2652221 | 2652496 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 141 | 171194 | 171478 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 142 | 96801 | 97115 | - | NZ_LR698975.1 | Methanosphaera stadtmanae |
| 143 | 73478 | 73717 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 144 | 1640695 | 1640976 | + | NZ_CP021434.1 | Tumebacillus avium |
| 145 | 3155315 | 3155599 | - | NZ_CP042434.1 | Arachidicoccus ginsenosidivorans |
| 146 | 391652 | 391936 | + | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 147 | 34939 | 35178 | + | NZ_CP014332.1 | Weissella jogaejeotgali |
| 148 | 436676 | 436960 | - | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 149 | 145145 | 145375 | + | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 150 | 784026 | 784256 | + | NC_014225.1 | Waddlia chondrophila WSU 86-1044 |
| 151 | 2842574 | 2842831 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 152 | 62236 | 62490 | + | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 153 | 2801587 | 2801883 | - | NZ_CP041345.1 | Tenuifilum thalassicum |
| 154 | 809984 | 810220 | + | NC_014122.1 | Methanocaldococcus infernus ME |
| 155 | 1018945 | 1019247 | + | NC_015518.1 | Acidianus hospitalis W1 |
| 156 | 3822456 | 3822716 | + | NZ_CP053352.1 | Winogradskyella helgolandensis |
| 157 | 43347 | 43580 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 158 | 5076330 | 5076584 | - | NZ_CP040336.1 | Bacillus luti |
| 159 | 42983 | 43219 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 160 | 43252 | 43488 | + | NC_011725.1 | Bacillus cereus B4264 |
| 161 | 3824643 | 3824939 | - | NZ_CP029480.1 | Arcticibacterium luteifluviistationis |
| 162 | 1627915 | 1628190 | - | NC_018014.1 | Terriglobus roseus DSM 18391 |
| 163 | 596595 | 596870 | + | NZ_AP019779.1 | Methanobrevibacter arboriphilus |
| 164 | 2189122 | 2189361 | - | NZ_CP027563.1 | Weissella confusa |
| 165 | 6068270 | 6068548 | + | NZ_CP042806.1 | Terriglobus albidus |
| 166 | 85231 | 85521 | + | NZ_CP045482.1 | Acidianus ambivalens |
| 167 | 432113 | 432382 | - | NZ_CP016312.1 | Thermus brockianus |
| 168 | 2031398 | 2031640 | - | NC_007955.1 | Methanococcoides burtonii DSM 6242 |
| 169 | 1070919 | 1071149 | - | NZ_CP038452.1 | Thermus caldilimi |
| 170 | 1212053 | 1212379 | - | NZ_CP007493.1 | Thermofilum adornatus 1505 |
| 171 | 2059033 | 2059311 | - | NC_015702.1 | Parachlamydia acanthamoebae UV-7 |
| 172 | 276232 | 276504 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 173 | 47651 | 47950 | + | NZ_CP012024.1 | Bacillus smithii |
| 174 | 35384 | 35665 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 175 | 2045099 | 2045392 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 176 | 158591 | 158824 | + | NZ_CP053989.1 | Niallia circulans |
++ More..