ProsmORF-pred
Result : B2UMP5
Protein Information
Information Type Description
Protein name Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-)
NCBI Accession ID CP001071.1
Organism Akkermansia muciniphila (strain ATCC BAA-835 / Muc)
Left 2171867
Right 2172160
Strand -
Nucleotide Sequence ATGAGCACGCCCCAAATAGACGTAGCCTACATTGCCAAGCTGGCACGCATTGACCTGACGGAGGAAGAAACAGCTCTCTTCTCCAAGGATCTGGACAAAGTCCTGGCCTATATCACCAAGCTGGAATCCTACGATGTCACGGGCATCGCCCCCATGAACCATCCTCTCCCGGCAATGGACGTGATGCGCGAAGACATTCCTGAAACCGGCTTCACCCAGGAAGAAGCCCTCTCCAATGCCCCCCAGCAGTCCCAGGGGCAATTCCGCACGCCCAAGGTGGTGGAATCCGCCTGA
Sequence MSTPQIDVAYIAKLARIDLTEEETALFSKDLDKVLAYITKLESYDVTGIAPMNHPLPAMDVMREDIPETGFTQEEALSNAPQQSQGQFRTPKVVESA
Source of smORF Swiss-Prot
Function Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}.
Pubmed ID 21390229
Domain CDD:412411
Functional Category Others
Uniprot ID B2UMP5
ORF Length (Amino Acid) 97
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 2
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2353260 2353553 - NZ_AP021898.1 Akkermansia muciniphila
2 756656 756949 + NZ_LT629973.1 Akkermansia glycaniphila
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_AP021898.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF01425.23 1.0 2 37.5 same-strand Amidase
++ More..