Result : B2UMP5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP001071.1 |
| Organism | Akkermansia muciniphila (strain ATCC BAA-835 / Muc) |
| Left | 2171867 |
| Right | 2172160 |
| Strand | - |
| Nucleotide Sequence | ATGAGCACGCCCCAAATAGACGTAGCCTACATTGCCAAGCTGGCACGCATTGACCTGACGGAGGAAGAAACAGCTCTCTTCTCCAAGGATCTGGACAAAGTCCTGGCCTATATCACCAAGCTGGAATCCTACGATGTCACGGGCATCGCCCCCATGAACCATCCTCTCCCGGCAATGGACGTGATGCGCGAAGACATTCCTGAAACCGGCTTCACCCAGGAAGAAGCCCTCTCCAATGCCCCCCAGCAGTCCCAGGGGCAATTCCGCACGCCCAAGGTGGTGGAATCCGCCTGA |
| Sequence | MSTPQIDVAYIAKLARIDLTEEETALFSKDLDKVLAYITKLESYDVTGIAPMNHPLPAMDVMREDIPETGFTQEEALSNAPQQSQGQFRTPKVVESA |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 21390229 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | B2UMP5 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2353260 | 2353553 | - | NZ_AP021898.1 | Akkermansia muciniphila |
| 2 | 756656 | 756949 | + | NZ_LT629973.1 | Akkermansia glycaniphila |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP021898.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01425.23 | 1.0 | 2 | 37.5 | same-strand | Amidase |
++ More..