Result : EXP01552
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01552 |
| NCBI Accession ID | BA000022.2 |
| Organism | Synechocystis sp. PCC 6803 |
| Left | 3317363 |
| Right | 3317593 |
| Strand | - |
| Nucleotide Sequence | ATGGAACTCACCCTAAATAATGTGGAAACGGTATTGGATGAACTCCGTCCCTACCTGATGGCTGACGGCGGCAATGTGGAAGTAGTAGAATTAGACGGTCCCATTGTCAAAGTACGTTTGCAGGGCGCTTGTGGATCCTGTCCCAGTTCCACCATGACCCTAAAAATGGGTATTGAGCGCAAATTAAGGGAAATGATCCCAGAAATTGCTGAAGTTGAGCAAGTCCTCTGA |
| Sequence | MELTLNNVETVLDELRPYLMADGGNVEVVELDGPIVKVRLQGACGSCPSSTMTLKMGIERKLREMIPEIAEVEQVL |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl29515. Profile Description: NifU-like domain. This is an alignment of the carboxy-terminal domain. This is the only common region between the NifU protein from nitrogen-fixing bacteria and rhodobacterial species. The biochemical function of NifU is unknown. |
| Pubmed ID | 30796087 |
| Domain | CDD:421844 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 286
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5070673 | 5070903 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 2 | 261166 | 261393 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 3 | 78522 | 78752 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 4 | 5154986 | 5155183 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 5 | 2861224 | 2861454 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 6 | 3510009 | 3510239 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 7 | 1427833 | 1428093 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 8 | 2848778 | 2849008 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 9 | 1048804 | 1049031 | - | NZ_CP031941.1 | Nostoc sphaeroides |
| 10 | 5115832 | 5116062 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 11 | 4811026 | 4811253 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 12 | 1910102 | 1910332 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 13 | 514732 | 514959 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 14 | 1424745 | 1424945 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 15 | 284908 | 285138 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 16 | 5133111 | 5133338 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 17 | 5930288 | 5930518 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 18 | 3738629 | 3738838 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 19 | 3287198 | 3287428 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 20 | 28318 | 28548 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 21 | 1397188 | 1397376 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 22 | 2283611 | 2283799 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 23 | 2373452 | 2373688 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 24 | 398766 | 398996 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 25 | 774813 | 775001 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 26 | 4254079 | 4254267 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 27 | 3226525 | 3226713 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 28 | 1513067 | 1513255 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 29 | 4628126 | 4628314 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 30 | 862817 | 863026 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 31 | 1278937 | 1279161 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 32 | 1344194 | 1344418 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 33 | 1110331 | 1110561 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 34 | 3636103 | 3636351 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 35 | 5306124 | 5306312 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 36 | 1396593 | 1396835 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 37 | 3071035 | 3071223 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 38 | 83654 | 83842 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 39 | 492814 | 493020 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 40 | 3704164 | 3704352 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 41 | 1037579 | 1037797 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 42 | 490456 | 490644 | - | NZ_CP034118.1 | Staphylospora marina |
| 43 | 3743221 | 3743445 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 44 | 3233090 | 3233311 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 45 | 808170 | 808391 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 46 | 1515747 | 1515965 | - | NZ_CP026363.1 | Brevibacillus agri |
| 47 | 3648164 | 3648385 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 48 | 869980 | 870177 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 49 | 724211 | 724411 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 50 | 3218599 | 3218820 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 51 | 3531238 | 3531438 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 52 | 1071616 | 1071852 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 53 | 3256717 | 3256905 | + | NZ_LS483476.1 | Lederbergia lentus |
| 54 | 3660076 | 3660312 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 55 | 1073397 | 1073633 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 56 | 877744 | 877965 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 57 | 964350 | 964559 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 58 | 1794613 | 1794822 | - | NZ_CP019699.1 | Novibacillus thermophilus |
| 59 | 2737227 | 2737415 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 60 | 663376 | 663615 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 61 | 2953848 | 2954057 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 62 | 3095445 | 3095654 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 63 | 2926035 | 2926268 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 64 | 1021465 | 1021686 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 65 | 3614051 | 3614272 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 66 | 1784596 | 1784838 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 67 | 1880414 | 1880650 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 68 | 1156930 | 1157127 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 69 | 2176223 | 2176462 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 70 | 1248913 | 1249119 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 71 | 1111896 | 1112102 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 72 | 1154282 | 1154488 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 73 | 590443 | 590649 | - | NZ_CP013661.2 | Planococcus kocurii |
| 74 | 1179903 | 1180109 | + | NZ_CP019401.1 | Planococcus faecalis |
| 75 | 1877934 | 1878173 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 76 | 437994 | 438215 | - | NZ_CP040336.1 | Bacillus luti |
| 77 | 4710878 | 4711099 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 78 | 4736420 | 4736641 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 79 | 4906510 | 4906731 | + | NC_011725.1 | Bacillus cereus B4264 |
| 80 | 4939635 | 4939856 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 81 | 3994853 | 3995074 | + | NZ_CP053989.1 | Niallia circulans |
| 82 | 3255862 | 3256062 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 83 | 3481540 | 3481740 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 84 | 3659153 | 3659353 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 85 | 36410 | 36619 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 86 | 3360726 | 3360914 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 87 | 1119695 | 1119901 | + | NZ_CP016540.2 | Planococcus versutus |
| 88 | 2669693 | 2669914 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 89 | 602379 | 602567 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 90 | 2690560 | 2690748 | + | NZ_CP012024.1 | Bacillus smithii |
| 91 | 1554126 | 1554347 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 92 | 2864832 | 2865053 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 93 | 780267 | 780488 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 94 | 335059 | 335250 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 95 | 1556227 | 1556451 | - | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 96 | 1071178 | 1071402 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 97 | 1543051 | 1543245 | + | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 98 | 1550588 | 1550815 | + | NZ_CP022657.1 | Tumebacillus algifaecis |
| 99 | 2404268 | 2404477 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 100 | 1294554 | 1294763 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 101 | 1912086 | 1912307 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 102 | 2005525 | 2005746 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 103 | 728714 | 728935 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 104 | 1756395 | 1756604 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 105 | 1908817 | 1909038 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 106 | 33565 | 33789 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 107 | 5036259 | 5036504 | + | NZ_AP019400.1 | Cohnella abietis |
| 108 | 838632 | 838853 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 109 | 100350 | 100562 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 110 | 1220364 | 1220585 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 111 | 405258 | 405479 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 112 | 1878749 | 1878970 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 113 | 196610 | 196831 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 114 | 1959255 | 1959443 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 115 | 607894 | 608115 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 116 | 2100385 | 2100606 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 117 | 858366 | 858587 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 118 | 2067637 | 2067858 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 119 | 858278 | 858478 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 120 | 910384 | 910605 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 121 | 1294969 | 1295196 | + | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 122 | 3315404 | 3315613 | + | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 123 | 4267306 | 4267506 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 124 | 2028856 | 2029077 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 125 | 1654926 | 1655132 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 126 | 3224207 | 3224404 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 127 | 885094 | 885315 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 128 | 1234480 | 1234701 | + | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 129 | 1449724 | 1449948 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 130 | 24835 | 25035 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 131 | 896434 | 896622 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 132 | 1995610 | 1995810 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 133 | 1202796 | 1203017 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 134 | 303875 | 304096 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 135 | 512159 | 512383 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 136 | 2427228 | 2427449 | - | NZ_CP034437.1 | Paenibacillus albus |
| 137 | 3294204 | 3294410 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 138 | 528347 | 528568 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 139 | 5010271 | 5010504 | - | NZ_CP021434.1 | Tumebacillus avium |
| 140 | 3476630 | 3476821 | - | NC_007517.1 | Geobacter metallireducens GS-15 |
| 141 | 2391092 | 2391283 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 142 | 964480 | 964704 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 143 | 2728256 | 2728483 | - | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 144 | 1984805 | 1985026 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 145 | 190454 | 190675 | - | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 146 | 3981020 | 3981238 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 147 | 1944208 | 1944408 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 148 | 1782180 | 1782368 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 149 | 4907418 | 4907636 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 150 | 1425242 | 1425463 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 151 | 1966194 | 1966400 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 152 | 1371687 | 1371875 | - | NZ_CP027770.1 | Staphylococcus felis |
| 153 | 1591704 | 1591904 | + | NZ_CP041217.1 | Saccharibacillus brassicae |
| 154 | 1986602 | 1986820 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 155 | 308747 | 308944 | + | NZ_CP061799.1 | Desulfonema limicola |
| 156 | 3537100 | 3537369 | - | NC_015177.1 | Pseudopedobacter saltans DSM 12145 |
| 157 | 2040423 | 2040692 | + | NZ_CP048106.1 | Pontibacter pudoricolor |
| 158 | 1650005 | 1650226 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 159 | 1582544 | 1582771 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 160 | 2561362 | 2561574 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 161 | 560588 | 560809 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 162 | 5773489 | 5773689 | + | NZ_CP021780.1 | Paenibacillus donghaensis |
| 163 | 3987032 | 3987250 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 164 | 1113349 | 1113546 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 165 | 3071627 | 3071851 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 166 | 2779185 | 2779421 | + | NZ_CP061813.1 | Polaribacter haliotis |
| 167 | 148942 | 149181 | + | NZ_CP009621.1 | Pontibacter korlensis |
| 168 | 3104731 | 3104919 | - | NZ_CP009788.1 | Geobacter pickeringii |
| 169 | 726392 | 726631 | + | NZ_CP014766.1 | Pontibacter akesuensis |
| 170 | 2647814 | 2648005 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 171 | 1452393 | 1452629 | - | NZ_CP019419.1 | Polaribacter reichenbachii |
| 172 | 1163431 | 1163649 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 173 | 9680 | 9871 | + | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 174 | 1849105 | 1849314 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 175 | 1626822 | 1627034 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 176 | 1413515 | 1413715 | + | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 177 | 3623025 | 3623261 | + | NC_018010.1 | Belliella baltica DSM 15883 |
| 178 | 2373359 | 2373580 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 179 | 1669342 | 1669563 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 180 | 1538106 | 1538327 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 181 | 903164 | 903382 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 182 | 1454029 | 1454250 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 183 | 2868624 | 2868863 | + | NZ_CP021235.1 | Pontibacter actiniarum |
| 184 | 280340 | 280555 | + | NZ_CP030041.1 | Echinicola strongylocentroti |
| 185 | 2853500 | 2853691 | + | NZ_CP012836.1 | Algoriphagus sanaruensis |
| 186 | 1762855 | 1763061 | - | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 187 | 1794373 | 1794612 | + | NZ_CP029463.1 | Flavobacterium sediminis |
| 188 | 2408320 | 2408544 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 189 | 4391172 | 4391366 | + | NZ_CP040106.1 | Echinicola rosea |
| 190 | 798154 | 798375 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 191 | 1733186 | 1733413 | + | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 192 | 1548411 | 1548611 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 193 | 4082461 | 4082706 | + | NC_015914.1 | Cyclobacterium marinum DSM 745 |
| 194 | 1395931 | 1396131 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 195 | 155212 | 155460 | - | NZ_CP054142.1 | Treponema parvum |
| 196 | 1477587 | 1477775 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 197 | 4170281 | 4170478 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| 198 | 1530117 | 1530317 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 199 | 3744842 | 3745042 | - | NZ_CP061800.1 | Desulfonema magnum |
| 200 | 1640430 | 1640651 | + | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 201 | 257291 | 257521 | + | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 202 | 2134900 | 2135094 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 203 | 1528818 | 1529027 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 204 | 5669693 | 5669962 | + | NZ_CP055156.1 | Adhaeribacter swui |
| 205 | 3987378 | 3987608 | - | NC_014655.1 | Leadbetterella byssophila DSM 17132 |
| 206 | 3983522 | 3983761 | - | NZ_CP047984.1 | Pontibacter russatus |
| 207 | 1451574 | 1451795 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 208 | 732613 | 732837 | + | NZ_CP036425.1 | Poriferisphaera corsica |
| 209 | 3887910 | 3888179 | + | NZ_CP055153.1 | Adhaeribacter radiodurans |
| 210 | 1085576 | 1085770 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 211 | 4767391 | 4767597 | + | NZ_CP020105.1 | Spirosoma rigui |
| 212 | 32283 | 32501 | - | NZ_CP018258.1 | Dehalogenimonas formicexedens |
| 213 | 887224 | 887445 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 214 | 800722 | 800943 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 215 | 2577871 | 2578068 | + | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 216 | 1802935 | 1803132 | - | NC_015520.1 | Mahella australiensis 50-1 BON |
| 217 | 3991312 | 3991527 | - | NC_019904.1 | Echinicola vietnamensis DSM 17526 |
| 218 | 4840144 | 4840335 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 219 | 3507352 | 3507591 | - | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 220 | 870018 | 870203 | + | NC_008576.1 | Magnetococcus marinus MC-1 |
| 221 | 3047691 | 3047912 | - | NZ_CP048649.1 | Aminipila butyrica |
| 222 | 887107 | 887328 | + | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 223 | 1467723 | 1467929 | - | NZ_CP053435.1 | Spirosoma taeanense |
| 224 | 1865025 | 1865246 | + | NC_007759.1 | Syntrophus aciditrophicus SB |
| 225 | 729490 | 729714 | - | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 226 | 150327 | 150536 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 227 | 1060340 | 1060528 | - | NC_008255.1 | Cytophaga hutchinsonii ATCC 33406 |
| 228 | 4275359 | 4275565 | + | NZ_CP020104.1 | Spirosoma aerolatum |
| 229 | 4788781 | 4789008 | + | NZ_CP029480.1 | Arcticibacterium luteifluviistationis |
| 230 | 555568 | 555789 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 231 | 1991144 | 1991365 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 232 | 204607 | 204831 | - | NC_015732.1 | Treponema caldarium DSM 7334 |
| 233 | 1686953 | 1687174 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 234 | 512113 | 512340 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 235 | 1035080 | 1035271 | - | NZ_CP030356.1 | Salinibacter ruber |
| 236 | 555462 | 555665 | - | NZ_CP019791.1 | Anaerohalosphaera lusitana |
| 237 | 1524213 | 1524434 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 238 | 1384114 | 1384338 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 239 | 5960505 | 5960711 | + | NC_013037.1 | Dyadobacter fermentans DSM 18053 |
| 240 | 1001035 | 1001265 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 241 | 3356959 | 3357174 | - | NZ_CP034562.1 | Flammeovirga pectinis |
| 242 | 320209 | 320433 | - | NC_011899.1 | Halothermothrix orenii H 168 |
| 243 | 3824751 | 3824939 | + | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 244 | 1722737 | 1722949 | - | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 245 | 8658899 | 8659114 | - | NC_019892.1 | Singulisphaera acidiphila DSM 18658 |
| 246 | 4041614 | 4041805 | + | NZ_CP012040.1 | Cyclobacterium amurskyense |
| 247 | 2381443 | 2381649 | - | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 248 | 2497616 | 2497840 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 249 | 600496 | 600708 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 250 | 3844235 | 3844486 | - | NZ_CP047897.1 | Nibribacter ruber |
| 251 | 2472089 | 2472325 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 252 | 3975181 | 3975444 | - | NC_018018.1 | Bernardetia litoralis DSM 6794 |
| 253 | 3042868 | 3043071 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 254 | 73376 | 73573 | - | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 255 | 3724068 | 3724289 | + | NZ_CP012332.1 | Vulgatibacter incomptus |
| 256 | 2368152 | 2368361 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 257 | 1556025 | 1556267 | + | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
| 258 | 1812814 | 1813017 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 259 | 979837 | 980046 | + | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 260 | 2388947 | 2389183 | + | NZ_LT906444.1 | Listeria welshimeri |
| 261 | 3717765 | 3717989 | - | NC_015578.1 | Treponema primitia ZAS-2 |
| 262 | 1375754 | 1375999 | + | NZ_CP063087.1 | Helicobacter winghamensis |
| 263 | 903809 | 904015 | - | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 264 | 2368693 | 2368929 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 265 | 2495449 | 2495685 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 266 | 156505 | 156732 | - | NZ_CP007028.1 | Thermocrinis ruber |
| 267 | 2756397 | 2756600 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 268 | 739492 | 739749 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 269 | 97332 | 97520 | - | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 270 | 2591603 | 2591821 | + | NZ_CP021904.1 | Alkalitalea saponilacus |
| 271 | 2025860 | 2026081 | + | NC_014654.1 | Halanaerobium hydrogeniformans |
| 272 | 3898113 | 3898334 | - | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 273 | 1374821 | 1375027 | + | NZ_CP006950.1 | Dehalococcoides mccartyi CG4 |
| 274 | 788613 | 788837 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 275 | 3438820 | 3439056 | + | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 276 | 1105703 | 1105909 | - | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 277 | 390738 | 390944 | + | NZ_CP043998.1 | Clostridium diolis |
| 278 | 38126 | 38350 | + | NC_014314.1 | Dehalogenimonas lykanthroporepellens BL-DC-9 |
| 279 | 931916 | 932119 | + | NC_013741.1 | Archaeoglobus profundus DSM 5631 |
| 280 | 734664 | 734891 | - | NC_017464.1 | Ignavibacterium album JCM 16511 |
| 281 | 3519394 | 3519612 | - | NC_017464.1 | Ignavibacterium album JCM 16511 |
| 282 | 530200 | 530421 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 283 | 2633595 | 2633804 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 284 | 1409009 | 1409221 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 285 | 746035 | 746262 | + | NC_021169.1 | Archaeoglobus sulfaticallidus PM70-1 |
| 286 | 2103123 | 2103344 | + | NZ_CP039543.1 | Desulfovibrio marinus |
| 287 | 1893807 | 1894052 | - | NZ_CP028136.1 | Gramella fulva |
| 288 | 414678 | 414911 | + | NZ_CP009302.1 | Berryella intestinalis |
| 289 | 1339495 | 1339701 | + | NC_013204.1 | Eggerthella lenta DSM 2243 |
| 290 | 2156301 | 2156501 | - | NC_018178.1 | Melioribacter roseus P3M-2 |
| 291 | 150748 | 150948 | + | NC_012440.1 | Persephonella marina EX-H1 |
| 292 | 783903 | 784091 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 293 | 2204426 | 2204659 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 294 | 625607 | 625813 | + | NZ_CP020953.1 | Clostridium drakei |
| 295 | 3639015 | 3639221 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 296 | 3694345 | 3694566 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 297 | 2007667 | 2007870 | - | NZ_CP011402.1 | Denitrobacterium detoxificans |
| 298 | 1389373 | 1389597 | + | NC_013170.1 | Cryptobacterium curtum DSM 15641 |
| 299 | 5444922 | 5445128 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 300 | 741128 | 741373 | - | NZ_CP034549.1 | Nonlabens ponticola |
| 301 | 741195 | 741410 | - | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
++ More..