Result : EXP01550
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01550 |
| NCBI Accession ID | NC_017381.1 |
| Organism | Helicobacter pylori 2018 |
| Left | 1247278 |
| Right | 1247508 |
| Strand | + |
| Nucleotide Sequence | ATGAAACGCTTTGATTTACGCCCCTTAAAAGCAGATATTTTTGAACGCTTAGAAGAATTGATTGAAAAAGAAATGCAACCTAATGAAGTCGCTATTTTCATGTTTGAAGTGGGGGATTTTTCTAATATCCCTAAGAGCGCTGAATTTATCCAATCTAAAGGGCATGAGCTCCTCAATTCTTTGCGTTTCAATCAAGCGGATTGGACGATTGTCGTGAGAAAAAAGGCTTGA |
| Sequence | MKRFDLRPLKADIFERLEELIEKEMQPNEVAIFMFEVGDFSNIPKSAEFIQSKGHELLNSLRFNQADWTIVVRKKA |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of pfam16514. Profile Description: putative NADH-ubiquinone oxidoreductase chain E. This putative NADH-ubiquinone oxidoreductase chain E family is found in Epsilonproteobacteria, chiefly in Helicobacter pylori. All proteins in the family are less than 100 residues in length. |
| Pubmed ID | 30796087 |
| Domain | CDD:374594 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 38
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1325651 | 1325881 | + | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 191277 | 191507 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 3 | 85786 | 86016 | + | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 4 | 209518 | 209748 | + | NZ_AP022826.1 | Nitrosophilus labii |
| 5 | 231513 | 231743 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 6 | 474236 | 474469 | + | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 7 | 148139 | 148372 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 8 | 1270895 | 1271125 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 9 | 910132 | 910401 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 10 | 2856285 | 2856551 | - | NZ_CP041070.1 | Arcobacter anaerophilus |
| 11 | 2556402 | 2556671 | - | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 12 | 2680119 | 2680385 | - | NZ_CP031218.1 | Malaciobacter halophilus |
| 13 | 2662018 | 2662272 | - | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 14 | 2783324 | 2783590 | - | NZ_CP032101.1 | Malaciobacter marinus |
| 15 | 2730825 | 2731091 | - | NZ_CP042812.1 | Malaciobacter canalis |
| 16 | 1719575 | 1719799 | - | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 17 | 1824566 | 1824790 | - | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 18 | 527450 | 527680 | - | NZ_CP021886.1 | Helicobacter apodemus |
| 19 | 190612 | 190851 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 20 | 255952 | 256176 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 21 | 186592 | 186831 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 22 | 732960 | 733187 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 23 | 2593895 | 2594137 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 24 | 649376 | 649603 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 25 | 145244 | 145483 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 26 | 826595 | 826849 | - | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 27 | 131655 | 131894 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 28 | 1375898 | 1376125 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 29 | 1529039 | 1529269 | - | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 30 | 1910248 | 1910469 | - | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 31 | 1506679 | 1506906 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 32 | 1340818 | 1341051 | - | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 33 | 1504824 | 1505051 | - | NZ_CP053848.1 | Campylobacter ornithocola |
| 34 | 1677641 | 1677865 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 35 | 259698 | 259928 | - | NZ_CP035946.1 | Campylobacter canadensis |
| 36 | 1383355 | 1383582 | - | NC_012039.1 | Campylobacter lari RM2100 |
| 37 | 504264 | 504491 | - | NZ_CP063079.1 | Campylobacter peloridis |
| 38 | 196635 | 196856 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017379.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00507.21 | 1.0 | 38 | 2527.0 | same-strand | NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 |
| 2 | PF01058.24 | 1.0 | 38 | 2036.0 | same-strand | NADH ubiquinone oxidoreductase, 20 Kd subunit |
| 3 | PF00329.21 | 1.0 | 38 | 1238.5 | same-strand | Respiratory-chain NADH dehydrogenase, 30 Kd subunit |
| 4 | PF00346.21 | 1.0 | 38 | 9.5 | same-strand | Respiratory-chain NADH dehydrogenase, 49 Kd subunit |
| 5 | PF10588.11 | 1.0 | 38 | 841 | same-strand | NADH-ubiquinone oxidoreductase-G iron-sulfur binding region |
| 6 | PF13510.8 | 1.0 | 38 | 841 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 7 | PF12838.9 | 1.0 | 38 | 4277.0 | same-strand | 4Fe-4S dicluster domain |
| 8 | PF13187.8 | 1.0 | 38 | 4167 | same-strand | 4Fe-4S dicluster domain |
| 9 | PF00146.23 | 1.0 | 38 | 3308.5 | same-strand | NADH dehydrogenase |
| 10 | PF00037.29 | 0.97 | 37 | 4284 | same-strand | 4Fe-4S binding domain |
| 11 | PF14697.8 | 0.61 | 23 | 4280.0 | same-strand | 4Fe-4S dicluster domain |
| 12 | PF13237.8 | 0.87 | 33 | 4280 | same-strand | 4Fe-4S dicluster domain |
| 13 | PF13183.8 | 0.92 | 35 | 4286.5 | same-strand | 4Fe-4S dicluster domain |
| 14 | PF00499.22 | 0.76 | 29 | 4915 | same-strand | NADH-ubiquinone/plastoquinone oxidoreductase chain 6 |
++ More..