ProsmORF-pred
Result : EXP01540
Protein Information
Information Type Description
Protein name EXP01540
NCBI Accession ID BA000022.2
Organism Synechocystis sp. PCC 6803
Left 1975575
Right 1975874
Strand -
Nucleotide Sequence GTGACCATTACCTTTGTTAAAGAGCAGAAGGATATTGTTGTGGCCCAGGGTGCCAACCTACGGGAAAAGGCCCTGCAGAATGGCGTTGATATTTATACCTTGAAAGGAAAACTGATGAACTGCGGAGGCTACGGCCAATGTGGCACTTGCATCGTGGAAATCACAGCGGGTATGGAAAATCTTTCCCCGAAAACCGACTTTGAAAATAGGGTATTGCGCAAAAAGCCCGACAATTTCCGTCTCGCCTGTCAAACCTTGGTCAATGGGCCGGTGAGTGTGAACACCAAACCCAAAGGCTAG
Sequence VTITFVKEQKDIVVAQGANLREKALQNGVDIYTLKGKLMNCGGYGQCGTCIVEITAGMENLSPKTDFENRVLRKKPDNFRLACQTLVNGPVSVNTKPKG
Source of smORF Protein-level
Function The ORF matches to the profile of cl00159. Profile Description: N/A. The 2Fe-2S ferredoxin family have a general core structure consisting of beta(2)-alpha-beta(2) which a beta-grasp type fold. The domain is around one hundred amino acids with four conserved cysteine residues to which the 2Fe-2S cluster is ligated. This cluster appears within sarcosine oxidase proteins.
Pubmed ID 30796087
Domain CDD:412190
Functional Category Conserved domain based functional assignment
Uniprot ID
ORF Length (Amino Acid) 99
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 29
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2440317 2440571 - NC_014501.1 Gloeothece verrucosa PCC 7822
2 3891959 3892213 + NC_011729.1 Gloeothece citriformis PCC 7424
3 677021 677317 - NC_019776.1 Cyanobacterium aponinum PCC 10605
4 3828989 3829285 + NC_019689.1 Pleurocapsa sp. PCC 7327
5 3301890 3302186 + NC_019748.1 Stanieria cyanosphaera PCC 7437
6 4164779 4165042 - NC_010296.1 Microcystis aeruginosa NIES-843
7 1899740 1900036 - NC_019753.1 Crinalium epipsammum PCC 9333
8 2369036 2369335 - NZ_CP018092.1 Synechococcus lividus PCC 6715
9 4965876 4966154 - NC_019729.1 Oscillatoria nigro-viridis PCC 7112
10 1473010 1473315 - NZ_AP018202.1 Thermostichus vulcanus NIES-2134
11 1595463 1595768 - NC_004113.1 Thermosynechococcus vestitus BP-1
12 4824517 4824846 - NZ_AP014638.1 Leptolyngbya boryana IAM M-101
13 4870124 4870381 + NC_019771.1 Anabaena cylindrica PCC 7122
14 518571 518828 - NC_014248.1 'Nostoc azollae' 0708
15 6290867 6291148 + NC_019695.1 Chroococcidiopsis thermalis PCC 7203
16 1612919 1613176 - NZ_CP054698.1 Nostoc edaphicum CCNP1411
17 347416 347712 + NC_010628.1 Nostoc punctiforme PCC 73102
18 176445 176702 + NZ_CP031941.1 Nostoc sphaeroides
19 554466 554762 - NZ_CP047242.1 Trichormus variabilis 0441
20 1676877 1677173 - NZ_CP060822.1 Cylindrospermopsis curvispora GIHE-G1
21 6505011 6505268 - NZ_CP024785.1 Nostoc flagelliforme CCNUN1
22 4432059 4432355 + NC_019751.1 Calothrix sp. PCC 6303
23 1808344 1808622 + NC_019693.1 Oscillatoria acuminata PCC 6304
24 524822 525070 + NC_019780.1 Dactylococcopsis salina PCC 8305
25 617621 617977 - NZ_CP021983.2 Halomicronema hongdechloris C2206
26 2086389 2086697 - NZ_CP042326.1 Euhalothece natronophila Z-M001
27 2015490 2015789 - NC_009925.1 Acaryochloris marina MBIC11017
28 1087209 1087460 - NC_022600.1 Gloeobacter kilaueensis JS1
29 3198374 3198625 - NC_005125.1 Gloeobacter violaceus PCC 7421
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_014501.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00582.28 0.62 18 459.0 opposite-strand Universal stress protein family
2 PF05151.14 0.66 19 144 same-strand Photosystem II reaction centre M protein (PsbM)
++ More..