Result : EXP01536
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01536 |
| NCBI Accession ID | BA000022.2 |
| Organism | Synechocystis sp. PCC 6803 |
| Left | 2543725 |
| Right | 2544018 |
| Strand | - |
| Nucleotide Sequence | GTGGAACTTTTTGACCTAGTGGAAGCGGTGGATCAGTTTATTGGCGATCGGCATACCTTACCGGATTTTTCCCTTACCCTGGAGCCCCTGTCCCGCCGCCACCGACAATCGGATGAACCCTTTGTGCAACGGGCCATTCCTGCCAGCTTGGGAGCTTTGGGCTTAGCGGTTTTTGCCCTGGTGCTCTACTGGCTGCCCATCCCCGAAATTCGGGAGCCGGAAGGGAACCCCGGCAACCCCCCTAATTTGGTCCAGCCGGGTAATGGCAATCCCCCCAATGGCCCCACTCCTTAA |
| Sequence | VELFDLVEAVDQFIGDRHTLPDFSLTLEPLSRRHRQSDEPFVQRAIPASLGALGLAVFALVLYWLPIPEIREPEGNPGNPPNLVQPGNGNPPNGPTP |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2900740 | 2901039 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 2 | 4706091 | 4706384 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 3 | 2906847 | 2907134 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_019689.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00528.24 | 0.67 | 2 | 1782.5 | opposite-strand | Binding-protein-dependent transport system inner membrane component |
| 2 | PF19300.1 | 0.67 | 2 | 1782.5 | opposite-strand | Binding-prot-dependent transport system membrane comp, N-term |
| 3 | PF11237.10 | 1.0 | 3 | 366 | same-strand | Protein of unknown function (DUF3038) |
++ More..