Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01536 |
NCBI Accession ID | BA000022.2 |
Organism | Synechocystis sp. PCC 6803 |
Left | 2543725 |
Right | 2544018 |
Strand | - |
Nucleotide Sequence | GTGGAACTTTTTGACCTAGTGGAAGCGGTGGATCAGTTTATTGGCGATCGGCATACCTTACCGGATTTTTCCCTTACCCTGGAGCCCCTGTCCCGCCGCCACCGACAATCGGATGAACCCTTTGTGCAACGGGCCATTCCTGCCAGCTTGGGAGCTTTGGGCTTAGCGGTTTTTGCCCTGGTGCTCTACTGGCTGCCCATCCCCGAAATTCGGGAGCCGGAAGGGAACCCCGGCAACCCCCCTAATTTGGTCCAGCCGGGTAATGGCAATCCCCCCAATGGCCCCACTCCTTAA |
Sequence | VELFDLVEAVDQFIGDRHTLPDFSLTLEPLSRRHRQSDEPFVQRAIPASLGALGLAVFALVLYWLPIPEIREPEGNPGNPPNLVQPGNGNPPNGPTP |
Source of smORF | Protein-level |
Function | |
Pubmed ID | 30796087 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 97 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2900740 | 2901039 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
2 | 4706091 | 4706384 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
3 | 2906847 | 2907134 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00528.24 | 0.67 | 2 | 1782.5 | opposite-strand | Binding-protein-dependent transport system inner membrane component |
2 | PF19300.1 | 0.67 | 2 | 1782.5 | opposite-strand | Binding-prot-dependent transport system membrane comp, N-term |
3 | PF11237.10 | 1.0 | 3 | 366 | same-strand | Protein of unknown function (DUF3038) |