Result : EXP01535
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01535 |
| NCBI Accession ID | NC_007633.1 |
| Organism | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| Left | 724303 |
| Right | 724548 |
| Strand | - |
| Nucleotide Sequence | ATGTTACTAACAAAAACTTTTTCAAATGGTGAGTTAGCTGGAATGCTAATTGGTGTAATTATTTTATCAATTATTATTGGATTAATTTTAGGGTTTGTAATTACTAGATATATGGTTAAAAAGCAATTAAAAGAAAATCCACCAATTACTGAAAAACAAATTAGAGCTATGTACATGAGTATGGGAAGAAAACCATCTGAAGCTGATATTAAAAAAACAATGAATGCTATTAAAAAAGCAAAATAA |
| Sequence | MLLTKTFSNGELAGMLIGVIILSIIIGLILGFVITRYMVKKQLKENPPITEKQIRAMYMSMGRKPSEADIKKTMNAIKKAK |
| Source of smORF | Protein-level |
| Function | integral component of membrane [GO:0016021] The ORF matches to the profile of cl23791. Profile Description: Uncharacterized protein family (UPF0154). hypothetical protein; Provisional |
| Pubmed ID | 30796087 |
| Domain | CDD:420010 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | Q8EX10 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 24
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 724303 | 724548 | - | NC_007633.1 | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| 2 | 435005 | 435253 | - | NZ_CP023173.1 | Mesoplasma chauliocola |
| 3 | 449588 | 449794 | - | NZ_CP024964.1 | Entomoplasma melaleucae |
| 4 | 404837 | 405043 | - | NC_006055.1 | Mesoplasma florum L1 |
| 5 | 420335 | 420541 | - | NZ_CP024411.1 | Mesoplasma entomophilum |
| 6 | 448123 | 448329 | - | NZ_CP024969.1 | Mesoplasma tabanidae |
| 7 | 490235 | 490438 | + | NZ_CP025257.1 | Mesoplasma syrphidae |
| 8 | 315404 | 315607 | - | NZ_CP023668.1 | Mesoplasma lactucae ATCC 49193 |
| 9 | 289765 | 290013 | + | NZ_CP007520.1 | Mycoplasma yeatsii GM274B |
| 10 | 406101 | 406346 | + | NZ_CP001668.1 | Mycoplasma mycoides subsp. capri str. GM12 |
| 11 | 383776 | 384024 | - | NZ_CP024962.1 | Entomoplasma freundtii |
| 12 | 509972 | 510220 | - | NZ_LS991954.1 | Mycoplasma putrefaciens |
| 13 | 443565 | 443822 | + | NZ_CP024965.1 | Entomoplasma somnilux |
| 14 | 607503 | 607700 | + | NZ_CP006681.1 | Spiroplasma culicicola AES-1 |
| 15 | 625571 | 625768 | - | NC_021846.1 | Spiroplasma taiwanense CT-1 |
| 16 | 715834 | 716073 | - | NZ_CP024963.1 | Entomoplasma luminosum |
| 17 | 1078957 | 1079154 | + | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 18 | 552647 | 552874 | - | NC_006908.1 | Mycoplasma mobile 163K |
| 19 | 25418 | 25624 | + | NZ_CP030141.1 | Mycoplasmopsis anatis |
| 20 | 352708 | 352941 | - | NZ_AP018940.1 | Mycoplasmopsis californica |
| 21 | 334300 | 334500 | + | NC_014921.1 | Mycoplasmopsis fermentans M64 |
| 22 | 48412 | 48615 | + | NC_004432.1 | Mycoplasma penetrans HF-2 |
| 23 | 400887 | 401123 | + | NC_014014.1 | Mycoplasma crocodyli MP145 |
| 24 | 159514 | 159738 | - | NZ_CP034044.1 | Mycoplasma struthionis |
++ More..