Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L32 |
NCBI Accession ID | CP001071.1 |
Organism | Akkermansia muciniphila (strain ATCC BAA-835 / Muc) |
Left | 330154 |
Right | 330345 |
Strand | - |
Nucleotide Sequence | ATGGCAGCACCTAAGCGCAGAACGTCCAAGATGAAGCAGCGTACCCGCCTTGCCGCTCAGGCATGGCGCGCGCCGAAGCTCCGCAAGTGCCAGAATTGCGGCAGCAGCACCCCCGGCCATACCGCTTGCCCCAATTGCGGTACGTACACGACCCGTTCCGGCAAGGAAATTGTGGTGAAAGCGGAAGCGTAA |
Sequence | MAAPKRRTSKMKQRTRLAAQAWRAPKLRKCQNCGSSTPGHTACPNCGTYTTRSGKEIVVKAEA |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
Pubmed ID | 21390229 |
Domain | CDD:415589 |
Functional Category | Ribosomal_protein |
Uniprot ID | B2UMG0 |
ORF Length (Amino Acid) | 63 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 379901 | 380092 | - | NZ_AP021898.1 | Akkermansia muciniphila |
2 | 2161198 | 2161389 | - | NZ_LT629973.1 | Akkermansia glycaniphila |
3 | 511850 | 512032 | + | NZ_CP051774.1 | Luteolibacter luteus |
4 | 2984357 | 2984536 | - | NZ_CP036275.1 | Maioricimonas rarisocia |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02504.17 | 1.0 | 4 | 96.5 | same-strand | Fatty acid synthesis protein |