Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01532 |
NCBI Accession ID | NC_000913.3 |
Organism | Escherichia coli K12 |
Left | 1315856 |
Right | 1316092 |
Strand | - |
Nucleotide Sequence | GTGTCGACACACAACACTCATATTAATGAAACAATGCAACGCAACGGGAGAAATAACATGGCCGAACATCGTGGTGGTTCAGGAAATTTCGCCGAAGACCGTGAGAAGGCATCCGACGCAGGCCGTAAAGGCGGTCAGCATAGCGGCGGTAATTTTAAAAATGATCCGCAACGCGCATCTGAAGCGGGTAAAAAAGGCGGTCAACAAAGCGGTGGTAATAAATCAGGCAAATCCTGA |
Sequence | VSTHNTHINETMQRNGRNNMAEHRGGSGNFAEDREKASDAGRKGGQHSGGNFKNDPQRASEAGKKGGQQSGGNKSGKS |
Source of smORF | Protein-level |
Function | |
Pubmed ID | 30796087 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 78 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1315856 | 1316092 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 1817013 | 1817216 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
3 | 1312178 | 1312414 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
4 | 2812103 | 2812324 | + | NZ_CP015113.1 | Kosakonia radicincitans |
5 | 2379345 | 2379566 | - | NZ_CP014007.2 | Kosakonia oryzae |
6 | 1592016 | 1592249 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
7 | 4336775 | 4337014 | + | NZ_CP053416.1 | Salmonella bongori |
8 | 2921013 | 2921237 | - | NZ_CP035129.1 | Kosakonia cowanii |
9 | 3646226 | 3646423 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
10 | 2243582 | 2243779 | - | NZ_AP022508.1 | Enterobacter bugandensis |
11 | 2216917 | 2217114 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
12 | 283389 | 283586 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
13 | 2287231 | 2287428 | - | NZ_CP009756.1 | Enterobacter cloacae |
14 | 2492261 | 2492458 | - | NZ_CP043318.1 | Enterobacter chengduensis |
15 | 2248580 | 2248777 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
16 | 4000486 | 4000722 | - | NZ_CP028271.1 | Mixta intestinalis |
17 | 277413 | 277625 | - | NZ_CP049115.1 | Pantoea stewartii |
18 | 441212 | 441472 | + | NZ_CP019706.1 | Pantoea alhagi |
19 | 1945842 | 1946057 | + | NZ_CP038853.1 | Pantoea vagans |
20 | 177579 | 177815 | - | NZ_CP061511.1 | Mixta calida |
21 | 242239 | 242475 | - | NZ_CP026377.1 | Mixta gaviniae |
22 | 3564127 | 3564360 | + | NZ_CP011835.1 | Azotobacter chroococcum |
23 | 131522 | 131725 | - | NZ_CP012406.1 | Azospirillum thiophilum |
24 | 2423365 | 2423589 | - | NZ_CP054205.1 | Pseudomonas rhodesiae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF05974.14 | 0.65 | 15 | 289 | same-strand | Domain of unknown function (DUF892) |