ProsmORF-pred
Result : EXP01523
Protein Information
Information Type Description
Protein name EXP01523
NCBI Accession ID NZ_CP009472.1
Organism Lactococcus lactis strain AI06
Left 1409806
Right 1410048
Strand -
Nucleotide Sequence ATGGCAATTACAAATGAACAAGTAGAACGCATTAATGAATTAGCGCGTAAGAAAAAAGCAGAAGGATTATCAGAAGCTGAACTTGAAGAACAAGCCCTTTTACGTCGTGCTTACCTCGATAGTGTTAAAGCAAATTTCCGCTCACAAGTTGAAACCATCAAAGTTATTGATGAAAAAACAGGAGAAGATGTTACTCCGGATAAACTTAAAGAAATTCAACGTAAGAATGGGATGCGCGACTGA
Sequence MAITNEQVERINELARKKKAEGLSEAELEEQALLRRAYLDSVKANFRSQVETIKVIDEKTGEDVTPDKLKEIQRKNGMRD
Source of smORF Protein-level
Function cytoplasm [GO:0005737]
The ORF matches to the profile of cl01722. Profile Description: Bacterial protein of unknown function (DUF896). hypothetical protein; Provisional
Pubmed ID 30796087
Domain CDD:413030
Functional Category Gene Ontology/Expression based functional assignment
Uniprot ID Q9CGJ9
ORF Length (Amino Acid) 80
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 103
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1065899 1066141 + NC_022369.1 Lactococcus lactis subsp. cremoris KW2
2 1089010 1089252 + NZ_CP070872.1 Lactococcus taiwanensis
3 751589 751831 + NZ_CP032627.1 Lactococcus allomyrinae
4 1515385 1515624 - NZ_CP065637.1 Lactococcus garvieae
5 1219267 1219518 + NZ_CP018061.1 Enterococcus mundtii
6 1860034 1860276 + NZ_CP023392.1 Lactococcus raffinolactis
7 859919 860161 - NZ_CP026116.1 Latilactobacillus curvatus JCM 1096 = DSM 20019
8 839398 839634 + NZ_CP068061.1 Mammaliicoccus vitulinus
9 1546355 1546594 - NZ_CP023074.1 Enterococcus thailandicus
10 1377374 1377613 + NZ_LR134304.1 Staphylococcus schweitzeri
11 1129822 1130058 + NC_014925.1 Staphylococcus pseudintermedius HKU10-03
12 2346422 2346658 + NZ_CP020773.1 Staphylococcus lutrae
13 1676280 1676531 + NC_020207.1 Enterococcus faecium ATCC 8459 = NRRL B-2354
14 1970186 1970443 - NZ_CP031733.1 Streptococcus chenjunshii
15 1662950 1663147 - NC_012924.1 Streptococcus suis SC84
16 1816353 1816589 + NZ_CP027770.1 Staphylococcus felis
17 1568580 1568816 - NZ_CP008747.1 Staphylococcus hyicus
18 1341658 1341909 + NZ_CP065211.1 Enterococcus lactis
19 1141462 1141701 + NZ_LS483306.1 Enterococcus cecorum
20 702936 703178 + NZ_CP045007.1 Latilactobacillus graminis
21 988159 988395 + NZ_CP045927.1 Staphylococcus agnetis
22 2206410 2206649 - NZ_CP033732.1 Staphylococcus hominis
23 1312835 1313074 + NZ_LT906460.1 Staphylococcus simiae
24 1324143 1324379 - NZ_CP022046.2 Mammaliicoccus sciuri
25 1811297 1811536 - NC_020995.1 Enterococcus casseliflavus EC20
26 291914 292171 + NZ_CP014699.1 Streptococcus pantholopis
27 2531009 2531293 - NZ_CP018796.1 Lentilactobacillus parabuchneri
28 1299218 1299454 - NZ_LT906464.1 Staphylococcus muscae
29 127964 128206 - NZ_CP046037.1 Latilactobacillus sakei
30 577685 577939 + NZ_CP011403.1 Ligilactobacillus salivarius str. Ren
31 1786349 1786603 - NZ_LT906439.1 Streptococcus merionis
32 1231947 1232147 + NZ_CP054482.1 Macrococcus bohemicus
33 1821405 1821656 + NZ_CP053988.1 Abiotrophia defectiva
34 1002552 1002785 + NZ_CP013911.1 Staphylococcus haemolyticus
35 446054 446290 - NZ_CP014022.1 Staphylococcus lugdunensis
36 1935876 1936079 + NZ_CP029971.1 Lentilactobacillus kefiri
37 274016 274213 - NZ_CP015196.1 Streptococcus marmotae
38 767338 767589 - NZ_CP045562.1 Fructilactobacillus fructivorans
39 1330412 1330654 - NZ_CP017195.1 Lactococcus paracarnosus
40 1409501 1409737 - NZ_LT906462.1 Mammaliicoccus stepanovicii
41 1614964 1615194 - NZ_AP018587.1 Staphylococcus caprae
42 1104628 1104882 + NZ_CP043405.1 Streptococcus ratti
43 1264883 1265089 - NZ_CP017194.1 Lactococcus carnosus
44 872799 873032 + NC_008525.1 Pediococcus pentosaceus ATCC 25745
45 933640 933873 + NZ_CP053421.1 Pediococcus acidilactici
46 112132 112389 - NZ_CP032620.1 Streptococcus koreensis
47 2620141 2620344 + NZ_CP012033.1 Levilactobacillus koreensis
48 818624 818821 + NZ_CP022680.1 Streptococcus respiraculi
49 1276208 1276432 + NC_007795.1 Staphylococcus aureus subsp. aureus NCTC 8325
50 960315 960566 + NZ_CP014872.1 Fructilactobacillus lindneri
51 1214689 1214910 - NZ_CP049886.1 Vagococcus coleopterorum
52 110242 110439 - NZ_CP016953.1 Streptococcus himalayensis
53 597020 597238 - NZ_CP065729.1 Macrococcus caseolyticus
54 1501195 1501419 - NZ_CP030105.1 Lactiplantibacillus plantarum
55 2106916 2107119 - NZ_CP032757.1 Lactiplantibacillus pentosus
56 1621560 1621757 + NZ_LR134341.1 Streptococcus pseudoporcinus
57 922721 922975 - NZ_CP019981.1 Pediococcus inopinatus
58 1495003 1495248 - NZ_LR134089.1 Staphylococcus saprophyticus
59 1030728 1030970 + NZ_CP040736.1 Companilactobacillus futsaii
60 722146 722397 + NZ_CP045240.1 Limosilactobacillus vaginalis
61 1757985 1758188 + NZ_CP019323.1 Companilactobacillus allii
62 652409 652645 + NZ_CP007601.1 Staphylococcus capitis subsp. capitis
63 1357027 1357233 - NZ_CP027563.1 Weissella confusa
64 1584897 1585145 - NZ_CP008724.1 Staphylococcus xylosus
65 394501 394722 + NZ_LS483343.1 Streptococcus ferus
66 1822719 1822964 + NZ_CP066042.1 Staphylococcus saccharolyticus
67 1498392 1498628 - NZ_LR134242.1 Staphylococcus warneri
68 2487225 2487461 + NC_022737.1 Staphylococcus pasteuri SP1
69 1521186 1521443 - NZ_CP064056.1 Staphylococcus lloydii
70 1552794 1553033 - NZ_CP040586.1 Furfurilactobacillus rossiae
71 801657 801896 - NZ_CP018199.1 Staphylococcus succinus
72 1566455 1566679 - NZ_LR594050.1 Streptococcus porcinus
73 1023228 1023449 - NZ_CP041364.1 Schleiferilactobacillus harbinensis
74 1552163 1552399 - NZ_CP035288.1 Staphylococcus epidermidis
75 902737 902970 + NZ_CP039712.1 Vagococcus zengguangii
76 1203869 1204123 - NZ_CP013237.1 Streptococcus mutans
77 2001763 2002020 + NZ_CP014835.1 Streptococcus halotolerans
78 1602748 1603005 - NZ_LS483383.1 Streptococcus cristatus ATCC 51100
79 1001090 1001320 - NC_016605.1 Pediococcus claussenii ATCC BAA-344
80 1115233 1115451 + NZ_CP047361.1 Macrococcus canis
81 1202361 1202609 + NZ_CP013114.1 Staphylococcus equorum
82 1838411 1838614 + NZ_CP059603.1 Levilactobacillus suantsaii
83 1659676 1659918 - NZ_CP018776.1 Staphylococcus condimenti
84 1521336 1521620 + NZ_CP047121.1 Lentilactobacillus hilgardii
85 1239593 1239826 + NZ_CP011366.1 Salinicoccus halodurans
86 1393234 1393467 - NZ_LS483405.1 Levilactobacillus brevis
87 2466219 2466419 + NZ_CP060414.1 Neisseria musculi
88 1102628 1102831 - NZ_LN898144.1 Paucilactobacillus oligofermentans DSM 15707 = LMG 22743
89 850574 850807 + NZ_CP014332.1 Weissella jogaejeotgali
90 882162 882395 - NZ_CP023501.1 Weissella paramesenteroides
91 371891 372088 + NZ_CP029491.1 Streptococcus sobrinus
92 1869902 1870141 - NZ_CP012502.1 Bacillus beveridgei
93 2427868 2428101 - NZ_CP022437.1 Virgibacillus necropolis
94 1089131 1089367 - NZ_CP061835.1 Weissella viridescens
95 1215774 1216022 - NZ_CP044499.1 Lapidilactobacillus dextrinicus
96 1076170 1076400 + NZ_CP068170.1 Erysipelatoclostridium ramosum
97 1634600 1634800 - NZ_CP031700.1 Neisseria zalophi
98 867429 867635 - NZ_CP017326.1 Weissella soli
99 1050998 1051237 + NZ_CP012047.1 Tetragenococcus halophilus
100 97667 97888 - NZ_CP018888.1 Amylolactobacillus amylophilus DSM 20533 = JCM 1125
101 465357 465596 - NZ_CP037940.1 Weissella cryptocerci
102 292996 293247 + NZ_CP022096.2 Staphylococcus pettenkoferi
103 580004 580234 - NZ_LR134313.1 Neisseria canis
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP026116.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00717.25 0.71 73 231 opposite-strand Peptidase S24-like
2 PF01726.18 0.74 76 218.5 opposite-strand LexA DNA binding domain
3 PF03672.15 0.66 68 2091.0 same-strand Uncharacterised protein family (UPF0154)
++ More..