Result : EXP01516
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01516 |
| NCBI Accession ID | NC_000913.3 |
| Organism | Escherichia coli K12 |
| Left | 1498645 |
| Right | 1498875 |
| Strand | + |
| Nucleotide Sequence | GTGCGTATGTTTCCAGAATACCGAGATTTAATATCCCGTCTGAAAAACGAAAATCCTCGCTTTATGTCCTTGTTCGATAAACACAATAAACTTGATCATGAAATTGCCAGAAAGGAAGGTTCCGACGGTCGAGGGTACAATGCGGAAGTGGTCCGCATGAAAAAACAAAAGCTACAGTTAAAAGATGAGATGCTCAAAATCCTGCAGCAGGAGAGCGTCAAAGAGGTGTAA |
| Sequence | VRMFPEYRDLISRLKNENPRFMSLFDKHNKLDHEIARKEGSDGRGYNAEVVRMKKQKLQLKDEMLKILQQESVKEV |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl01070. Profile Description: Protein of unknown function (DUF465). hypothetical protein; Provisional |
| Pubmed ID | 30796087 |
| Domain | CDD:412724 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | P0ACW6 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 90
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1821070 | 1821300 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 1498645 | 1498875 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 2266028 | 2266258 | - | NZ_LR134340.1 | Escherichia marmotae |
| 4 | 1486398 | 1486628 | + | NZ_AP014857.1 | Escherichia albertii |
| 5 | 2016291 | 2016521 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 6 | 3873612 | 3873836 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 7 | 3070498 | 3070722 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 8 | 1712602 | 1712829 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 9 | 1415566 | 1415796 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 10 | 1026751 | 1026975 | - | NZ_CP038469.1 | Citrobacter tructae |
| 11 | 4795482 | 4795706 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 12 | 214056 | 214280 | - | NZ_CP033744.1 | Citrobacter freundii |
| 13 | 2922047 | 2922265 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 14 | 2505365 | 2505592 | - | NC_012880.1 | Musicola paradisiaca Ech703 |
| 15 | 4208778 | 4209011 | + | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 16 | 3566149 | 3566376 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 17 | 840145 | 840369 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 18 | 2243926 | 2244147 | - | NZ_LR134201.1 | Cedecea lapagei |
| 19 | 2414636 | 2414857 | + | NZ_CP023525.1 | Cedecea neteri |
| 20 | 5461704 | 5461934 | + | NZ_CP011254.1 | Serratia fonticola |
| 21 | 1332750 | 1332968 | + | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 22 | 3095721 | 3095951 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 23 | 25526 | 25744 | - | NZ_CP016176.1 | Xenorhabdus hominickii |
| 24 | 273797 | 274021 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 25 | 546229 | 546447 | - | NZ_CP060401.1 | Xenorhabdus nematophila |
| 26 | 3073113 | 3073331 | - | NZ_CP029736.1 | Providencia rettgeri |
| 27 | 3611195 | 3611407 | + | NZ_CP029736.1 | Providencia rettgeri |
| 28 | 2258918 | 2259145 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 29 | 1863410 | 1863637 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 30 | 3071083 | 3071304 | + | NZ_CP026364.1 | Proteus hauseri |
| 31 | 394308 | 394523 | + | NZ_CP026364.1 | Proteus hauseri |
| 32 | 3429226 | 3429453 | + | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 33 | 1323692 | 1323916 | + | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 34 | 1326131 | 1326355 | - | NZ_CP029185.2 | Limnobaculum parvum |
| 35 | 532213 | 532449 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 36 | 2609188 | 2609406 | + | NZ_LR134531.1 | Pragia fontium |
| 37 | 2907423 | 2907644 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 38 | 2538205 | 2538426 | - | NZ_CP023706.1 | Edwardsiella tarda |
| 39 | 773041 | 773262 | + | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 40 | 1058350 | 1058571 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 41 | 2105684 | 2105899 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 42 | 841331 | 841552 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 43 | 3037794 | 3038018 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 44 | 1117281 | 1117514 | - | NZ_CP050150.1 | Hafnia alvei |
| 45 | 2406026 | 2406253 | + | NZ_LS483470.1 | Leminorella richardii |
| 46 | 2691433 | 2691657 | - | NZ_CP027666.1 | Ottowia oryzae |
| 47 | 3842016 | 3842240 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 48 | 431935 | 432153 | - | NC_007952.1 | Paraburkholderia xenovorans LB400 |
| 49 | 1493237 | 1493449 | - | NZ_LS483422.1 | Providencia heimbachae |
| 50 | 1477349 | 1477564 | + | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 51 | 288318 | 288539 | + | NZ_CP027669.1 | Simplicispira suum |
| 52 | 164899 | 165120 | - | NZ_CP047165.1 | Pelistega ratti |
| 53 | 1178717 | 1178932 | - | NZ_CP032519.1 | Cupriavidus oxalaticus |
| 54 | 1848950 | 1849162 | + | NZ_LT906448.1 | Pasteurella dagmatis |
| 55 | 2449425 | 2449643 | - | NZ_CP045302.1 | Azotobacter salinestris |
| 56 | 2424496 | 2424717 | - | NZ_LR134378.1 | Lautropia mirabilis |
| 57 | 2670269 | 2670484 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 58 | 2103900 | 2104112 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 59 | 229763 | 229981 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 60 | 243142 | 243354 | + | NC_012560.1 | Azotobacter vinelandii DJ |
| 61 | 2252695 | 2252910 | + | NZ_CP021455.1 | Comamonas serinivorans |
| 62 | 1513633 | 1513848 | - | NZ_AP022345.1 | Fluviibacter phosphoraccumulans |
| 63 | 905927 | 906139 | + | NZ_CP028926.1 | Pasteurella multocida |
| 64 | 1043619 | 1043837 | + | NZ_LT906482.1 | Eikenella corrodens |
| 65 | 1304185 | 1304406 | - | NC_010622.1 | Paraburkholderia phymatum STM815 |
| 66 | 1862483 | 1862701 | + | NZ_CP038018.1 | Eikenella exigua |
| 67 | 587595 | 587807 | - | NZ_CP046378.1 | Shewanella algae |
| 68 | 1757504 | 1757734 | + | NZ_CP012196.1 | Campylobacter gracilis |
| 69 | 3286579 | 3286803 | + | NZ_CP053986.1 | Achromobacter denitrificans |
| 70 | 2304154 | 2304372 | + | NZ_CP037867.1 | Hydrogenophaga pseudoflava |
| 71 | 1473871 | 1474101 | + | NZ_CP059569.1 | Kingella oralis |
| 72 | 1513380 | 1513604 | + | NZ_LT906434.1 | Neisseria zoodegmatis |
| 73 | 1230017 | 1230208 | - | NZ_AP019378.1 | Bordetella parapertussis |
| 74 | 3159728 | 3159919 | + | NZ_LR134326.1 | Bordetella bronchiseptica |
| 75 | 1730028 | 1730252 | - | NZ_CP038034.1 | Achromobacter insolitus |
| 76 | 829999 | 830223 | + | NZ_CP012543.1 | Campylobacter rectus |
| 77 | 1302116 | 1302340 | - | NZ_CP012544.1 | Campylobacter showae |
| 78 | 2135251 | 2135475 | - | NZ_CP014234.1 | Moraxella osloensis |
| 79 | 1107233 | 1107457 | - | NZ_CP060414.1 | Neisseria musculi |
| 80 | 1527126 | 1527344 | - | NZ_CP048796.1 | Providencia vermicola |
| 81 | 1306001 | 1306231 | + | NC_017379.1 | Helicobacter pylori Puno135 |
| 82 | 1060379 | 1060612 | - | NZ_CP028901.1 | Algicoccus marinus |
| 83 | 983140 | 983367 | + | NZ_CP059443.1 | Campylobacter fetus |
| 84 | 1034154 | 1034381 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 85 | 2627417 | 2627629 | + | NC_010645.1 | Bordetella avium 197N |
| 86 | 2374973 | 2375185 | + | NZ_CP031123.2 | Providencia huaxiensis |
| 87 | 3265424 | 3265639 | + | NZ_AP022188.1 | Aeromonas media |
| 88 | 1409145 | 1409360 | - | NZ_LR134376.1 | Aeromonas encheleia |
| 89 | 2002779 | 2002994 | + | NZ_CP051883.1 | Aeromonas salmonicida |
| 90 | 1641090 | 1641305 | + | NZ_CP044060.1 | Aeromonas veronii |
| 91 | 1928190 | 1928405 | + | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 92 | 3289510 | 3289734 | + | NZ_AP022642.1 | Pseudomonas otitidis |
| 93 | 1619522 | 1619737 | - | NZ_CP050851.1 | Aeromonas hydrophila |
| 94 | 1214150 | 1214380 | - | NZ_CP007445.1 | Gilliamella apicola |
++ More..