Result : EXP01513
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01513 |
| NCBI Accession ID | BA000022.2 |
| Organism | Synechocystis sp. PCC 6803 |
| Left | 1780062 |
| Right | 1780298 |
| Strand | + |
| Nucleotide Sequence | TTGAGGGGAATTGCAGGAAAACTGATGAGCAGATTTGATAGCGGATTACCCAGTGTCCGCCAAGTACAGCTTTTGATCAAGGATCAAACCCCGGTGGAAATCAAACTACTAACGGGGGATTCCCTCTTCGGCACCATTCGTTGGCAAGATACCGATGGCCTAGGGCTAGTCGATGACTCTGAACGTTCTACCATTGTGCGCCTAGCGGCGATCGCCTACATTACTCCCCGCCGTTAG |
| Sequence | LRGIAGKLMSRFDSGLPSVRQVQLLIKDQTPVEIKLLTGDSLFGTIRWQDTDGLGLVDDSERSTIVRLAAIAYITPRR |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00259. Profile Description: Sm and related proteins. This SM domain is found in Ataxin-2. |
| Pubmed ID | 30796087 |
| Domain | CDD:412267 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5449069 | 5449302 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 2 | 3944342 | 3944560 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 3 | 4028815 | 4029018 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 4 | 6329321 | 6329515 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 5 | 2543567 | 2543779 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 6 | 672112 | 672327 | - | NZ_CP031941.1 | Nostoc sphaeroides |
| 7 | 524077 | 524292 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_019695.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00999.23 | 0.86 | 6 | 2001.5 | opposite-strand | Sodium/hydrogen exchanger family |
| 2 | PF02080.23 | 0.86 | 6 | 2001.5 | opposite-strand | TrkA-C domain |
| 3 | PF02254.20 | 0.86 | 6 | 2001.5 | opposite-strand | TrkA-N domain |
| 4 | PF01678.21 | 1.0 | 7 | 105 | opposite-strand | Diaminopimelate epimerase |
++ More..