Protein Information |
Information Type | Description |
---|---|
Protein name | 30S ribosomal protein S20 |
NCBI Accession ID | CP001071.1 |
Organism | Akkermansia muciniphila (strain ATCC BAA-835 / Muc) |
Left | 1990691 |
Right | 1990954 |
Strand | - |
Nucleotide Sequence | ATGGCCAATACCAAATCCGCACTCAAGCGCATCCGCCAGACAGCAACCCGCACCGCCCGCAACCGCGCCGTGACCTCCAAGTTGAAGACCCTCCGCAAGAAAGTTGCCGCTGCGGTGGAAACGTCCGACAAGGAAGCCGCTGCTGCTGCCTACAACACTTTCTCCTCAGCCGTTGACAAAGCCGCCAAGGTTGGCACCATTCCCGCCAATCGTGCAGCCAACTACAAGAGCAAGGCCGCCAAGGCCATCGCAAAAATCGCCTGA |
Sequence | MANTKSALKRIRQTATRTARNRAVTSKLKTLRKKVAAAVETSDKEAAAAAYNTFSSAVDKAAKVGTIPANRAANYKSKAAKAIAKIA |
Source of smORF | Swiss-Prot |
Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
Pubmed ID | 21390229 |
Domain | CDD:412349 |
Functional Category | Ribosomal_protein |
Uniprot ID | B2UM23 |
ORF Length (Amino Acid) | 87 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2167207 | 2167470 | - | NZ_AP021898.1 | Akkermansia muciniphila |
2 | 2066332 | 2066595 | - | NZ_LT629973.1 | Akkermansia glycaniphila |
3 | 2786480 | 2786737 | + | NC_014008.1 | Coraliomargarita akajimensis DSM 45221 |
4 | 1432771 | 1433031 | - | NZ_CP036250.1 | Egicoccus halophilus |
5 | 4213715 | 4213978 | + | NZ_CP051774.1 | Luteolibacter luteus |
6 | 2146224 | 2146484 | + | NC_015588.1 | Isoptericola variabilis 225 |
7 | 1123637 | 1123897 | - | NZ_CP051884.1 | Cellulomonas taurus |
8 | 12111433 | 12111717 | - | NC_010162.1 | Sorangium cellulosum So ce56 |
9 | 1466505 | 1466774 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
10 | 2338140 | 2338403 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
11 | 2833814 | 2834074 | + | NZ_CP023344.1 | Nibricoccus aquaticus |