Result : EXP01498
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01498 |
| NCBI Accession ID | NZ_CP009472.1 |
| Organism | Lactococcus lactis strain AI06 |
| Left | 1512692 |
| Right | 1512955 |
| Strand | - |
| Nucleotide Sequence | ATGCGCGCAGTTGTAACAGTAGTAGGAGCAGATAAAATTGGGATTGTTGCTGGAGTCACAGCAACATTGGCAGAACTTGAAGCAAATATCATTGAAATTTCACAAACCTTGATGAGTGGAGCTTTTACCATGATGATGGTAGTTGAAACACAAAATAGTGATTTTTTAGCCTTTCAAGCAGAACTTTCAAGAAAAGGTGAAGCCTTGGGTGTCAATATTCATGTTCAAAATGAAGCAATTTTTAACGCCATGCACAAATTATAA |
| Sequence | MRAVVTVVGADKIGIVAGVTATLAELEANIIEISQTLMSGAFTMMMVVETQNSDFLAFQAELSRKGEALGVNIHVQNEAIFNAMHKL |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl09141. Profile Description: ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme. The ACT domain is a structural motif of 70-90 amino acids that functions in the control of metabolism, solute transport and signal transduction. They are thus found in a variety of different proteins in a variety of different arrangements. In mammalian phenylalanine hydroxylase the domain forms no contacts but promotes an allosteric effect despite the apparent lack of ligand binding. |
| Pubmed ID | 30796087 |
| Domain | CDD:415594 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | Q92EC3 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 61
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 963196 | 963459 | + | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 2 | 1002439 | 1002702 | + | NZ_CP070872.1 | Lactococcus taiwanensis |
| 3 | 1051910 | 1052173 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 4 | 1270593 | 1270859 | + | NZ_AP022822.1 | Enterococcus saigonensis |
| 5 | 1216128 | 1216394 | - | NZ_CP012541.1 | Campylobacter concisus |
| 6 | 474719 | 474988 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 7 | 31453 | 31722 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 8 | 3833686 | 3833997 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 9 | 2247555 | 2247788 | - | NZ_LR134483.1 | Listeria grayi |
| 10 | 1723461 | 1723730 | - | NZ_CP012047.1 | Tetragenococcus halophilus |
| 11 | 531906 | 532139 | + | NZ_LT906444.1 | Listeria welshimeri |
| 12 | 570952 | 571185 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 13 | 1268282 | 1268548 | - | NZ_LS483306.1 | Enterococcus cecorum |
| 14 | 1542836 | 1543105 | + | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 15 | 163332 | 163601 | + | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 16 | 1952728 | 1952994 | - | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 17 | 2632083 | 2632352 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 18 | 544918 | 545187 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 19 | 193048 | 193314 | - | NC_020208.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 20 | 2964849 | 2965118 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 21 | 910989 | 911270 | + | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 22 | 326413 | 326679 | - | NZ_CP023392.1 | Lactococcus raffinolactis |
| 23 | 182397 | 182666 | + | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 24 | 1489575 | 1489841 | - | NZ_CP017195.1 | Lactococcus paracarnosus |
| 25 | 66885 | 67154 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 26 | 2310279 | 2310545 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 27 | 1406641 | 1406907 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 28 | 149904 | 150167 | + | NZ_CP013213.1 | Erysipelothrix larvae |
| 29 | 1705340 | 1705606 | - | NZ_CP014699.1 | Streptococcus pantholopis |
| 30 | 154651 | 154917 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 31 | 1435019 | 1435285 | + | NZ_CP012544.1 | Campylobacter showae |
| 32 | 681427 | 681693 | + | NZ_CP012543.1 | Campylobacter rectus |
| 33 | 1861474 | 1861740 | - | NZ_CP012196.1 | Campylobacter gracilis |
| 34 | 938836 | 939105 | - | NC_014122.1 | Methanocaldococcus infernus ME |
| 35 | 286766 | 287032 | + | NC_012924.1 | Streptococcus suis SC84 |
| 36 | 892683 | 892940 | + | NZ_CP014324.1 | Oenococcus oeni |
| 37 | 1059979 | 1060245 | + | NZ_CP054015.1 | Streptococcus gallolyticus |
| 38 | 266796 | 267062 | + | NZ_CP039457.1 | Streptococcus pasteurianus |
| 39 | 2023053 | 2023319 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 40 | 329760 | 330026 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 41 | 121609 | 121875 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| 42 | 317728 | 318024 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 43 | 150073 | 150339 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 44 | 1520129 | 1520395 | - | NZ_CP013237.1 | Streptococcus mutans |
| 45 | 78842 | 79108 | + | NZ_AP014612.1 | Streptococcus troglodytae |
| 46 | 572528 | 572794 | + | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 47 | 202749 | 203021 | - | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 48 | 208576 | 208842 | + | NZ_LS483343.1 | Streptococcus ferus |
| 49 | 749406 | 749672 | + | NZ_CP043405.1 | Streptococcus ratti |
| 50 | 2230518 | 2230784 | + | NZ_LT906439.1 | Streptococcus merionis |
| 51 | 1900858 | 1901124 | - | NZ_CP040736.1 | Companilactobacillus futsaii |
| 52 | 1597134 | 1597400 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
| 53 | 626889 | 627155 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 54 | 1973012 | 1973278 | - | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 55 | 248429 | 248701 | - | NZ_CP042374.1 | Leuconostoc carnosum |
| 56 | 940686 | 940952 | + | NZ_CP032620.1 | Streptococcus koreensis |
| 57 | 1549749 | 1550021 | + | NC_009634.1 | Methanococcus vannielii SB |
| 58 | 1126850 | 1127065 | - | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 59 | 1141234 | 1141449 | - | NZ_CP015247.1 | Leuconostoc suionicum |
| 60 | 546017 | 546232 | + | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 61 | 1746970 | 1747248 | + | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 62 | 1328036 | 1328305 | + | NC_015732.1 | Treponema caldarium DSM 7334 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_022369.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05167.14 | 0.97 | 59 | 16 | same-strand | Uncharacterised ACR (DUF711) |
++ More..