Result : EXP01494
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01494 |
| NCBI Accession ID | NC_017381.1 |
| Organism | Helicobacter pylori 2018 |
| Left | 821718 |
| Right | 821966 |
| Strand | - |
| Nucleotide Sequence | TTGAAAAACATTTATGTAGGGAATTTGGTTTATAGCGCTACTAGTGAGCAAGTTAAGGAGCTTTTCAGTCAATTTGGCAAAGTTTTTAATGTCAAGCTGATTTATGACAGAGAAACGAAGAAACCTAAAGGTTTTGGCTTTGTGGAAATGCAAGAAGAGGGCGTTAGGGAAGCGATTGCTAAATTGGACAATACGGATTTTATGGGCAGAACAATTAGAGTAACCGAAGCCAATCCTAAAAAGTCTTAA |
| Sequence | LKNIYVGNLVYSATSEQVKELFSQFGKVFNVKLIYDRETKKPKGFGFVEMQEEGVREAIAKLDNTDFMGRTIRVTEANPKKS |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl17169. Profile Description: RNA recognition motif (RRM) superfamily. Crp79, also called meiotic expression up-regulated protein 5 (Mug5), or polyadenylate-binding protein crp79, or PABP, or poly(A)-binding protein, is an auxiliary mRNA export factor that binds the poly(A) tail of mRNA and is involved in the export of mRNA from the nucleus to the cytoplasm. Mug28 is a meiosis-specific protein that regulates spore wall formation. Members in this family contain three RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains). The model corresponds to the three RRM motif. |
| Pubmed ID | 30796087 |
| Domain | CDD:418427 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 69
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 827469 | 827717 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 1032834 | 1033082 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 3 | 321685 | 321933 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 4 | 716374 | 716619 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 5 | 163879 | 164124 | - | NZ_CP014991.1 | Helicobacter himalayensis |
| 6 | 316541 | 316792 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 7 | 624992 | 625237 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 8 | 14228 | 14494 | + | NC_020127.1 | Lawsonia intracellularis N343 |
| 9 | 564277 | 564522 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 10 | 749122 | 749400 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 11 | 2018601 | 2018864 | + | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 12 | 1721209 | 1721469 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 13 | 3423100 | 3423363 | - | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 14 | 1707937 | 1708200 | - | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 15 | 2632252 | 2632500 | - | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 16 | 1908007 | 1908252 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 17 | 2225079 | 2225345 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 18 | 2315139 | 2315348 | - | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 19 | 177699 | 177944 | - | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 20 | 420370 | 420636 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 21 | 1060188 | 1060436 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 22 | 525162 | 525371 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 23 | 1657835 | 1658044 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 24 | 874276 | 874485 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 25 | 2977159 | 2977422 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 26 | 921691 | 921954 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 27 | 3572235 | 3572480 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 28 | 1208206 | 1208472 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 29 | 196177 | 196446 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 30 | 2241083 | 2241346 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 31 | 2409468 | 2409677 | + | NZ_CP039543.1 | Desulfovibrio marinus |
| 32 | 335656 | 335871 | - | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 33 | 1463897 | 1464160 | - | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 34 | 137342 | 137608 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 35 | 718804 | 719067 | + | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 36 | 191908 | 192177 | + | NZ_AP022826.1 | Nitrosophilus labii |
| 37 | 593681 | 593932 | - | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 38 | 2720545 | 2720760 | - | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 39 | 878372 | 878629 | - | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 40 | 2403338 | 2403586 | + | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 41 | 1296801 | 1297076 | - | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 42 | 3580822 | 3581097 | + | NZ_CP038033.1 | Nitrosococcus wardiae |
| 43 | 1346876 | 1347148 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 44 | 2536780 | 2536992 | - | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 45 | 2314915 | 2315166 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 46 | 1597180 | 1597455 | + | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 47 | 1394717 | 1394971 | + | NZ_CP027432.2 | Caminibacter pacificus |
| 48 | 2283205 | 2283456 | - | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 49 | 227117 | 227368 | - | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 50 | 1127811 | 1128056 | - | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
| 51 | 3142623 | 3142901 | + | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
| 52 | 59810 | 60067 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 53 | 997832 | 998110 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 54 | 174676 | 174933 | + | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 55 | 1281741 | 1282019 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 56 | 1239096 | 1239350 | + | NC_012115.1 | Nautilia profundicola AmH |
| 57 | 229546 | 229794 | - | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
| 58 | 1199912 | 1200196 | + | NZ_CP019633.1 | Sedimentisphaera cyanobacteriorum |
| 59 | 1402871 | 1403146 | - | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 60 | 1961782 | 1962051 | - | NZ_CP013816.1 | Piscirickettsia salmonis |
| 61 | 461500 | 461778 | + | NZ_CP011971.1 | Steroidobacter denitrificans |
| 62 | 2494547 | 2494828 | - | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 63 | 1279418 | 1279663 | + | NZ_CP041660.1 | Catenovulum sediminis |
| 64 | 599594 | 599806 | + | NZ_CP053826.1 | Campylobacter curvus |
| 65 | 521739 | 521963 | + | NZ_CP012541.1 | Campylobacter concisus |
| 66 | 170578 | 170796 | + | NZ_CP053836.1 | Halarcobacter ebronensis |
| 67 | 1304570 | 1304818 | - | NZ_CP044060.1 | Aeromonas veronii |
| 68 | 765165 | 765413 | + | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 69 | 1430682 | 1430891 | - | NZ_CP014056.2 | Grimontia hollisae |
| 70 | 459704 | 459973 | + | NZ_CP014671.1 | Immundisolibacter cernigliae |
| 71 | 132860 | 133093 | + | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 72 | 127233 | 127466 | + | NZ_CP053835.1 | Arcobacter defluvii |
| 73 | 45723 | 45956 | - | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 74 | 107819 | 108052 | + | NZ_CP032097.1 | Arcobacter ellisii |
| 75 | 104286 | 104552 | + | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 76 | 210250 | 210477 | + | NZ_CP029844.1 | Blattabacterium clevelandi |
| 77 | 206423 | 206650 | + | NC_016621.1 | Blattabacterium sp. (Cryptocercus punctulatus) str. Cpu |
| 78 | 1991730 | 1991975 | + | NZ_AP022188.1 | Aeromonas media |
| 79 | 276854 | 277096 | - | NZ_CP027523.1 | Pseudoalteromonas carrageenovora |
| 80 | 876727 | 876972 | + | NZ_CP051883.1 | Aeromonas salmonicida |
| 81 | 63106 | 63339 | + | NZ_CP030944.1 | Arcobacter aquimarinus |
| 82 | 1959611 | 1959856 | + | NZ_CP050851.1 | Aeromonas hydrophila |
| 83 | 127557 | 127829 | - | NC_002932.3 | Chlorobaculum tepidum TLS |
| 84 | 5313768 | 5314019 | + | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 85 | 1631501 | 1631752 | + | NZ_CP040449.1 | Aeromonas simiae |
| 86 | 2557697 | 2557942 | - | NZ_LR134376.1 | Aeromonas encheleia |
| 87 | 3549927 | 3550196 | - | NC_015578.1 | Treponema primitia ZAS-2 |
| 88 | 2520269 | 2520520 | - | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 89 | 87154 | 87387 | + | NZ_CP035928.1 | Malaciobacter pacificus |
| 90 | 2811465 | 2811740 | - | NZ_CP023777.1 | Chitinophaga caeni |
| 91 | 173463 | 173708 | + | NZ_CP041070.1 | Arcobacter anaerophilus |
++ More..