Result : EXP01488
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01488 |
| NCBI Accession ID | BA000022.2 |
| Organism | Synechocystis sp. PCC 6803 |
| Left | 2857495 |
| Right | 2857755 |
| Strand | + |
| Nucleotide Sequence | TTGAGGTTTACCATGTGTATTTGTGTGAACTGCCATTACGTGGACCGCTGTATCACCTACCATGCAGTGGAACATCAACATCAACAACCCCATTTGAGCGATCGCCCGGATTTTGATCCGGTCAACCCTTCTATCAACGTAAATATTCGTACCCCCGACCATGGCATCGAAATGGAATGGGATGTGGTGGGTTGCGACAGTTTTTTACAAGAAATGGGCAAATGGAGCCGTTTACGCCCCAATGAATTAGTCCCCACCTAG |
| Sequence | LRFTMCICVNCHYVDRCITYHAVEHQHQQPHLSDRPDFDPVNPSINVNIRTPDHGIEMEWDVVGCDSFLQEMGKWSRLRPNELVPT |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of pfam10718. Profile Description: Hypothetical chloroplast protein Ycf34. This family is of proteins annotated as hypothetical chloroplast protein YCF34. The function is not known. |
| Pubmed ID | 30796087 |
| Domain | CDD:402382 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 30
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4403600 | 4403848 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 2 | 3175214 | 3175462 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 3 | 4938732 | 4938980 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 4 | 3750130 | 3750339 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 5 | 6082923 | 6083171 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 6 | 3396693 | 3396941 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 7 | 7161313 | 7161561 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 8 | 3090653 | 3090901 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 9 | 1696938 | 1697186 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 10 | 3591477 | 3591725 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 11 | 5547221 | 5547469 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 12 | 1741643 | 1741891 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 13 | 3069515 | 3069763 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 14 | 202172 | 202420 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 15 | 3215346 | 3215594 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 16 | 1198216 | 1198464 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 17 | 2548762 | 2548983 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 18 | 2571349 | 2571570 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 19 | 2567327 | 2567575 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 20 | 194610 | 194846 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 21 | 2822569 | 2822796 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 22 | 1929731 | 1929952 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 23 | 2628360 | 2628608 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 24 | 5057750 | 5057998 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 25 | 4700194 | 4700442 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 26 | 3629841 | 3630089 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 27 | 4908667 | 4908915 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 28 | 454778 | 454993 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 29 | 4623048 | 4623290 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 30 | 163506 | 163757 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP021983.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01743.22 | 0.63 | 19 | 106 | opposite-strand | Poly A polymerase head domain |
| 2 | PF13735.8 | 0.7 | 21 | 109 | opposite-strand | tRNA nucleotidyltransferase domain 2 putative |
| 3 | PF12627.9 | 0.73 | 22 | 107.5 | opposite-strand | Probable RNA and SrmB- binding site of polymerase A |
++ More..