Result : EXP01485
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01485 |
| NCBI Accession ID | NC_017502.1 |
| Organism | Mycoplasma gallisepticum R(high) |
| Left | 663853 |
| Right | 664146 |
| Strand | - |
| Nucleotide Sequence | ATGAATATTAAACCACTACACGATAATGTTTTAGTTGAAGTTTTAGCTGAAGCAAAAACTTCAAAATTAGGGATCATTACAACTATTCAAAACCCTGACAAAGCGACATCAACCAAAGGTTTAGTAATCGCTTTGGGTGATGGGATGATCTATGCTAAACAACAAAAAGTTGATTATCAAATTAAGGTTAATGACCATGTTTATTTTAAGGAATATTCAGGGACAGAGATCGTAGTTAATGATAAAACTTATAAGATCTTAAGTTATGAAGAAATCATTGGGGTAATTAGATAA |
| Sequence | MNIKPLHDNVLVEVLAEAKTSKLGIITTIQNPDKATSTKGLVIALGDGMIYAKQQKVDYQIKVNDHVYFKEYSGTEIVVNDKTYKILSYEEIIGVIR |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl09113. Profile Description: N/A. This family contains GroES and Gp31-like chaperonins. Gp31 is a functional co-chaperonin that is required for the folding and assembly of Gp23, a major capsid protein, during phage morphogenesis. |
| Pubmed ID | 30796087 |
| Domain | CDD:415587 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 619806 | 620099 | - | NC_018406.1 | Mycoplasma gallisepticum VA94_7994-1-7P |
| 2 | 589602 | 589895 | - | NZ_CP059674.1 | Mycoplasma tullyi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_018406.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00154.23 | 1.0 | 2 | 2924.5 | same-strand | recA bacterial DNA recombination protein |
| 2 | PF08423.13 | 1.0 | 2 | 2924.5 | same-strand | Rad51 |
| 3 | PF00118.26 | 1.0 | 2 | 0.0 | same-strand | TCP-1/cpn60 chaperonin family |
| 4 | PF00365.22 | 1.0 | 2 | 1548.5 | same-strand | Phosphofructokinase |
++ More..