Result : EXP01480
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01480 |
| NCBI Accession ID | NC_017548.1 |
| Organism | Pseudomonas aeruginosa M18 |
| Left | 4426019 |
| Right | 4426261 |
| Strand | + |
| Nucleotide Sequence | ATGGACTATTTCATCATCGTCGTCACCACCGCCGCCGGCCTGTATTTCCACTGGTGGATCTACTGGCGCATCCGCCGCTGGATGGACCGCGACCTGGCGCTGTCATTCGCCGGCGACGACCCGCAAAAGCGTGACTATCTGTTACAGCGACTGGCCGAGGCCAAGGCCAGCAAGGTGAAGCGGCGCGACCTGCCGGCCTGGCTGGAGCGCGCCGCCGCCGACTACCCTTCCCGCGAAGCCTGA |
| Sequence | MDYFIIVVTTAAGLYFHWWIYWRIRRWMDRDLALSFAGDDPQKRDYLLQRLAEAKASKVKRRDLPAWLERAAADYPSREA |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 40
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1140838 | 1141080 | - | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 2 | 5547888 | 5548124 | + | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 3 | 4571818 | 4572054 | + | NZ_CP014205.2 | Pseudomonas glycinae |
| 4 | 1501764 | 1502000 | - | NZ_CP029608.1 | Pseudomonas kribbensis |
| 5 | 1174167 | 1174403 | - | NZ_CP014870.1 | Pseudomonas silesiensis |
| 6 | 1466049 | 1466285 | - | NZ_CP062253.1 | Pseudomonas gozinkensis |
| 7 | 1431673 | 1431909 | - | NZ_CP062252.1 | Pseudomonas allokribbensis |
| 8 | 1417604 | 1417840 | - | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 9 | 2461726 | 2461962 | + | NZ_CP005960.1 | Pseudomonas mandelii JR-1 |
| 10 | 1399938 | 1400222 | - | NZ_CP035088.1 | Pseudomonas viciae |
| 11 | 1185195 | 1185476 | - | NZ_CP062158.2 | Pseudomonas lundensis |
| 12 | 1473203 | 1473439 | - | NZ_LS999205.1 | Pseudomonas protegens CHA0 |
| 13 | 1944381 | 1944617 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 14 | 1570763 | 1570999 | - | NZ_CP014158.1 | Pseudomonas citronellolis |
| 15 | 1562735 | 1562983 | - | NZ_AP022642.1 | Pseudomonas otitidis |
| 16 | 1231875 | 1232108 | - | NC_021505.1 | Pseudomonas putida NBRC 14164 |
| 17 | 1404874 | 1405110 | - | NZ_CP034725.1 | Pseudomonas brassicacearum |
| 18 | 1516524 | 1516766 | + | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
| 19 | 1499705 | 1499941 | - | NZ_CP051487.1 | Pseudomonas umsongensis |
| 20 | 749846 | 750088 | - | NZ_CP070505.1 | Pseudomonas toyotomiensis |
| 21 | 4473409 | 4473645 | + | NZ_CP071706.1 | Pseudomonas donghuensis |
| 22 | 1475427 | 1475663 | - | NZ_CP047698.1 | Pseudomonas knackmussii |
| 23 | 2670998 | 2671234 | + | NZ_CP011835.1 | Azotobacter chroococcum |
| 24 | 4473270 | 4473506 | - | NZ_CP045302.1 | Azotobacter salinestris |
| 25 | 1341030 | 1341260 | - | NC_008027.1 | Pseudomonas entomophila L48 |
| 26 | 1762768 | 1763010 | + | NZ_CP060009.1 | Pseudomonas sediminis |
| 27 | 4995687 | 4995971 | - | NZ_CP014262.1 | Pseudomonas corrugata |
| 28 | 4596194 | 4596427 | + | NZ_CP022562.1 | Pseudomonas monteilii |
| 29 | 1389416 | 1389652 | - | NZ_CP046621.1 | Pseudomonas alkylphenolica |
| 30 | 1343657 | 1343887 | - | NZ_CP024159.1 | Pseudomonas mosselii |
| 31 | 3541025 | 3541255 | + | NZ_CP009365.1 | Pseudomonas soli |
| 32 | 1664130 | 1664390 | - | NZ_CP054205.1 | Pseudomonas rhodesiae |
| 33 | 3047268 | 3047510 | - | NZ_CP068551.1 | Pseudomonas khazarica |
| 34 | 1450425 | 1450685 | - | NZ_CP023272.1 | Pseudomonas lurida |
| 35 | 1525714 | 1525956 | - | NZ_CP018420.1 | Pseudomonas veronii |
| 36 | 2787058 | 2787291 | + | NZ_CP048810.1 | Pseudomonas bijieensis |
| 37 | 1838605 | 1838838 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
| 38 | 1481498 | 1481737 | - | NZ_CP043311.1 | Pseudomonas lalkuanensis |
| 39 | 583057 | 583317 | + | NZ_CP012362.1 | Oblitimonas alkaliphila |
| 40 | 769756 | 769992 | + | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP014205.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00691.22 | 0.85 | 34 | 691.0 | opposite-strand | OmpA family |
| 2 | PF01243.22 | 0.85 | 34 | 10.0 | opposite-strand | Pyridoxamine 5'-phosphate oxidase |
| 3 | PF10590.11 | 0.85 | 34 | 10.0 | opposite-strand | Pyridoxine 5'-phosphate oxidase C-terminal dimerisation region |
| 4 | PF12766.9 | 0.85 | 34 | 10.0 | opposite-strand | Pyridoxamine 5'-phosphate oxidase |
| 5 | PF05433.17 | 0.85 | 34 | 166.5 | opposite-strand | Glycine zipper 2TM domain |
| 6 | PF13441.8 | 0.65 | 26 | 169.0 | opposite-strand | YMGG-like Gly-zipper |
| 7 | PF13488.8 | 0.6 | 24 | 168.0 | opposite-strand | Glycine zipper |
| 8 | PF00144.26 | 0.78 | 31 | 1889 | opposite-strand | Beta-lactamase |
| 9 | PF13307.8 | 0.68 | 27 | 5436 | opposite-strand | Helicase C-terminal domain |
++ More..