Result : EXP01478
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01478 |
| NCBI Accession ID | BA000022.2 |
| Organism | Synechocystis sp. PCC 6803 |
| Left | 2127879 |
| Right | 2128127 |
| Strand | + |
| Nucleotide Sequence | ATGATTAAACTCCGTCTAAAACGCTTTGGTAAGAAACGTGAAGTTAGCTATCGGATCGTTGCCATGCACAGCACCACCCGCCGGGATGGTCGCCCCTTGGAAGAATTAGGATTCTATAATCCCCGCACCGATGAAACTCGCCTTGATGTACCGGCGATCGTCAAAAGATTAAAAGAAGGTGCCCAACCCACCGACACCGTCCGCTCCATTTTGACCAAAGCCCAGGTTTTCGAACAGCTAAAAGCTTAG |
| Sequence | MIKLRLKRFGKKREVSYRIVAMHSTTRRDGRPLEELGFYNPRTDETRLDVPAIVKRLKEGAQPTDTVRSILTKAQVFEQLKA |
| Source of smORF | Protein-level |
| Function | translation [GO:0006412];ribosome [GO:0005840];structural constituent of ribosome [GO:0003735] The ORF matches to the profile of cl00368. Profile Description: Ribosomal protein S16. This model describes ribosomal S16 of bacteria and organelles. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 30796087 |
| Domain | CDD:412339 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | B8J1U2 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 59
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5838242 | 5838490 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 2 | 2338609 | 2338857 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 3 | 3550280 | 3550528 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 4 | 1720390 | 1720638 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 5 | 1589415 | 1589699 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 6 | 2040135 | 2040395 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 7 | 208986 | 209234 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 8 | 585655 | 585918 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 9 | 3531822 | 3532082 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 10 | 2577952 | 2578212 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 11 | 397824 | 398084 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 12 | 4498782 | 4499048 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 13 | 3704012 | 3704284 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 14 | 2676718 | 2676966 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 15 | 1682835 | 1683089 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 16 | 1227347 | 1227607 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 17 | 2062427 | 2062699 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 18 | 2250415 | 2250663 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 19 | 5302114 | 5302362 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 20 | 137787 | 138050 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 21 | 3216693 | 3216941 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 22 | 3084715 | 3084966 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 23 | 4139676 | 4139930 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 24 | 6538059 | 6538319 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 25 | 1025450 | 1025698 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 26 | 389926 | 390177 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 27 | 35569 | 35820 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 28 | 931685 | 931897 | - | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 29 | 705479 | 705700 | - | NC_020127.1 | Lawsonia intracellularis N343 |
| 30 | 2619337 | 2619570 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 31 | 1057787 | 1058020 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 32 | 3904966 | 3905199 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 33 | 842158 | 842391 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 34 | 1127275 | 1127487 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 35 | 884508 | 884777 | - | NZ_AP019711.1 | Amedibacterium intestinale |
| 36 | 302035 | 302277 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 37 | 1794270 | 1794503 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 38 | 3000721 | 3000954 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 39 | 2287928 | 2288146 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 40 | 749763 | 750008 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 41 | 769012 | 769257 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 42 | 762793 | 763038 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 43 | 869434 | 869703 | + | NZ_CP011391.1 | Faecalibaculum rodentium |
| 44 | 2319655 | 2319888 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 45 | 580285 | 580530 | + | NC_013895.2 | Mageeibacillus indolicus UPII9-5 |
| 46 | 211959 | 212168 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 47 | 508985 | 509230 | + | NZ_CP014161.1 | Aerococcus urinae |
| 48 | 3741567 | 3741806 | + | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 49 | 1376469 | 1376714 | - | NZ_CP034234.1 | Erysipelothrix piscisicarius |
| 50 | 1311529 | 1311774 | + | NZ_LR134439.1 | Erysipelothrix rhusiopathiae |
| 51 | 1040598 | 1040843 | + | NZ_CP014159.1 | Aerococcus christensenii |
| 52 | 1451801 | 1452061 | - | NZ_CP014164.1 | Aerococcus viridans |
| 53 | 724650 | 724910 | + | NZ_CP013988.1 | Aerococcus urinaeequi |
| 54 | 985556 | 985828 | + | NZ_CP013213.1 | Erysipelothrix larvae |
| 55 | 1713084 | 1713302 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 56 | 565975 | 566187 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 57 | 842158 | 842421 | + | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
| 58 | 1851910 | 1852155 | + | NC_023035.1 | Salinispira pacifica |
| 59 | 3505959 | 3506189 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_019748.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13083.8 | 0.93 | 55 | 8 | same-strand | KH domain |
| 2 | PF00448.24 | 0.69 | 41 | 122 | same-strand | SRP54-type protein, GTPase domain |
| 3 | PF02978.21 | 0.69 | 41 | 116 | same-strand | Signal peptide binding domain |
| 4 | PF02881.21 | 0.69 | 41 | 122 | same-strand | SRP54-type protein, helical bundle domain |
++ More..