Result : EXP01477
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01477 |
| NCBI Accession ID | NZ_CP001668.1 |
| Organism | Mycoplasma mycoides subsp. capri LC str. 95010 |
| Left | 529696 |
| Right | 529902 |
| Strand | + |
| Nucleotide Sequence | GTGAAGTTTATGGCAAGAAGAGATGCATTAACTGGTAAAAGTGCTTTATCAGGTCAATCAAGATCACACGCATTAAATGCAACTAAAAGAAAATGAAACTTAAATCTACAAAAGGTTAGAGTAATGGATGAAAATGGTAGTGTATTTAATATCAAAGTATCTGCTAGAACATTAAGAACTCTAAAAAAACAAGAAAAAATCGTTTAA |
| Sequence | VKFMARRDALTGKSALSGQSRSHALNATKRKWNLNLQKVRVMDENGSVFNIKVSARTLRTLKKQEKIV |
| Source of smORF | Protein-level |
| Function | translation [GO:0006412];ribosome [GO:0005840];structural constituent of ribosome [GO:0003735] The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 30796087 |
| Domain | CDD:412338 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | Q2SS02 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 125
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 946169 | 946369 | + | NZ_CP038013.1 | Spiroplasma gladiatoris |
| 2 | 519259 | 519456 | + | NC_006908.1 | Mycoplasma mobile 163K |
| 3 | 874842 | 875039 | + | NZ_LR214951.1 | Mycoplasma neurolyticum |
| 4 | 756336 | 756527 | - | NZ_LR215039.1 | Mycoplasmopsis columboralis |
| 5 | 158253 | 158444 | + | NZ_LR215024.1 | Mycoplasmopsis glycophila |
| 6 | 705423 | 705614 | + | NZ_LR214950.1 | Mycoplasmopsis gallinacea |
| 7 | 847620 | 847811 | - | NC_002771.1 | Mycoplasmopsis pulmonis UAB CTIP |
| 8 | 718705 | 718896 | + | NZ_CP040825.1 | Mycoplasma nasistruthionis |
| 9 | 2831 | 3028 | + | NZ_CP008748.1 | Mycoplasma hyosynoviae |
| 10 | 603134 | 603331 | - | NZ_CP030140.1 | Mycoplasma anseris |
| 11 | 2766 | 2963 | + | NZ_LR215047.1 | Mycoplasma arthritidis |
| 12 | 1143978 | 1144172 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 13 | 189142 | 189339 | - | NZ_CP030103.1 | Mycoplasma cloacale |
| 14 | 490361 | 490552 | - | NZ_LR215031.1 | Mycoplasmopsis gallopavonis |
| 15 | 2835 | 3032 | + | NZ_CP033058.2 | Mycoplasma phocicerebrale |
| 16 | 110014 | 110220 | + | NC_009497.1 | Mycoplasmopsis agalactiae PG2 |
| 17 | 3269 | 3466 | + | NZ_CP029295.1 | Mycoplasma phocidae |
| 18 | 209181 | 209372 | + | NZ_LR214986.1 | Mycoplasmopsis cynos |
| 19 | 116075 | 116281 | + | NZ_CP005933.1 | Mycoplasmopsis bovis CQ-W70 |
| 20 | 561067 | 561258 | + | NZ_LR215036.1 | Mycoplasmopsis citelli |
| 21 | 643544 | 643741 | - | NZ_LR214938.2 | Mycoplasma salivarium |
| 22 | 5592 | 5789 | + | NZ_CP055143.1 | Mycoplasma hominis |
| 23 | 2801 | 2998 | + | NZ_LS991949.1 | Mycoplasma alkalescens |
| 24 | 494568 | 494771 | - | NZ_LR215037.1 | Mycoplasmopsis maculosa |
| 25 | 136696 | 136890 | + | NZ_CP007154.1 | Mycoplasma bovoculi M165/69 |
| 26 | 491724 | 491921 | + | NZ_AP014657.1 | Mycoplasmopsis arginini |
| 27 | 1754730 | 1754921 | + | NZ_CP012196.1 | Campylobacter gracilis |
| 28 | 216235 | 216432 | + | NZ_AP014631.1 | Mycoplasma canadense |
| 29 | 956414 | 956614 | - | NC_014921.1 | Mycoplasmopsis fermentans M64 |
| 30 | 692839 | 693030 | + | NZ_LR214972.1 | Mycoplasmopsis bovirhinis |
| 31 | 360994 | 361191 | + | NZ_CP034044.1 | Mycoplasma struthionis |
| 32 | 728762 | 728953 | - | NZ_CP011368.1 | Mycoplasmopsis canis |
| 33 | 533041 | 533235 | + | NC_000908.2 | Mycoplasma genitalium G37 |
| 34 | 2602418 | 2602606 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 35 | 224132 | 224326 | - | NZ_CP024161.1 | Mycoplasma dispar |
| 36 | 162619 | 162810 | + | NZ_LS991951.1 | Mycoplasmopsis edwardii |
| 37 | 197649 | 197831 | + | NC_021283.1 | Mycoplasma hyopneumoniae 168-L |
| 38 | 387276 | 387464 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 39 | 598985 | 599176 | - | NZ_CP014163.1 | Aerococcus urinaehominis |
| 40 | 186838 | 187029 | + | NZ_AP022325.1 | Mycoplasmopsis felis |
| 41 | 583418 | 583612 | + | NZ_AP018940.1 | Mycoplasmopsis californica |
| 42 | 715127 | 715318 | + | NZ_LR214970.1 | Mycoplasmopsis bovigenitalium |
| 43 | 4008076 | 4008264 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 44 | 1204777 | 1204968 | + | NZ_CP011391.1 | Faecalibaculum rodentium |
| 45 | 1453622 | 1453810 | - | NZ_CP036246.2 | [Arcobacter] porcinus |
| 46 | 1383552 | 1383740 | - | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 47 | 767983 | 768174 | - | NC_014014.1 | Mycoplasma crocodyli MP145 |
| 48 | 1485208 | 1485396 | - | NZ_CP040336.1 | Bacillus luti |
| 49 | 3744098 | 3744286 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 50 | 3879142 | 3879330 | + | NC_011725.1 | Bacillus cereus B4264 |
| 51 | 3883376 | 3883564 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 52 | 1031393 | 1031584 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 53 | 878304 | 878495 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 54 | 381408 | 381602 | + | NZ_CP034841.1 | Mycoplasmopsis phocirhinis |
| 55 | 980558 | 980749 | + | NZ_CP059443.1 | Campylobacter fetus |
| 56 | 1168202 | 1168393 | + | NZ_CP013213.1 | Erysipelothrix larvae |
| 57 | 1031137 | 1031331 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 58 | 3674546 | 3674734 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 59 | 1265235 | 1265426 | + | NZ_CP053826.1 | Campylobacter curvus |
| 60 | 2748885 | 2749073 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 61 | 866887 | 867075 | + | NZ_LR215050.1 | Acholeplasma hippikon |
| 62 | 2360080 | 2360277 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 63 | 3381901 | 3382089 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 64 | 681100 | 681300 | + | NZ_LR215041.1 | Mycoplasmopsis columbina |
| 65 | 1682958 | 1683146 | - | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 66 | 1100348 | 1100539 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 67 | 2231961 | 2232149 | - | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 68 | 1648605 | 1648793 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 69 | 1993793 | 1993981 | - | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 70 | 1567345 | 1567536 | - | NZ_CP014164.1 | Aerococcus viridans |
| 71 | 1550717 | 1550914 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 72 | 403914 | 404114 | - | NZ_LR215043.1 | Mycoplasmopsis columbinasalis |
| 73 | 731504 | 731695 | - | NZ_CP012541.1 | Campylobacter concisus |
| 74 | 2342186 | 2342374 | - | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 75 | 2479132 | 2479320 | - | NZ_CP053840.1 | Arcobacter venerupis |
| 76 | 637523 | 637714 | + | NZ_CP013988.1 | Aerococcus urinaeequi |
| 77 | 69161 | 69361 | + | NZ_LR215042.1 | Mycoplasmopsis meleagridis |
| 78 | 426893 | 427084 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 79 | 1455966 | 1456157 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 80 | 887867 | 888055 | + | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 81 | 2007117 | 2007305 | + | NZ_CP012502.1 | Bacillus beveridgei |
| 82 | 2159498 | 2159686 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 83 | 672502 | 672690 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 84 | 1761480 | 1761668 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 85 | 1784087 | 1784275 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 86 | 1783458 | 1783646 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 87 | 35307 | 35501 | - | NZ_CP031611.1 | Campylobacter hepaticus |
| 88 | 1833955 | 1834143 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 89 | 1562995 | 1563183 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 90 | 1659695 | 1659883 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 91 | 1622135 | 1622323 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 92 | 1628466 | 1628654 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 93 | 330337 | 330525 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 94 | 1655599 | 1655787 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 95 | 1624878 | 1625066 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 96 | 1648539 | 1648727 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 97 | 2006563 | 2006751 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 98 | 1559822 | 1560010 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 99 | 1621756 | 1621944 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 100 | 521513 | 521701 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 101 | 2358996 | 2359184 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 102 | 1746509 | 1746697 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 103 | 1794954 | 1795142 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 104 | 1287611 | 1287799 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 105 | 1874660 | 1874848 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 106 | 1652102 | 1652290 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 107 | 1480644 | 1480832 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 108 | 1694579 | 1694767 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 109 | 2390643 | 2390831 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 110 | 1623639 | 1623827 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 111 | 1682137 | 1682325 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 112 | 173004 | 173192 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 113 | 3413688 | 3413876 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 114 | 2201958 | 2202149 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 115 | 4202787 | 4202975 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 116 | 977740 | 977928 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 117 | 511901 | 512083 | - | NZ_CP007585.1 | Mycoplasma flocculare ATCC 27399 |
| 118 | 1967225 | 1967413 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 119 | 1093621 | 1093812 | - | NZ_CP053842.1 | Campylobacter corcagiensis |
| 120 | 655272 | 655457 | - | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 121 | 1104528 | 1104713 | + | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 122 | 1235482 | 1235670 | + | NZ_CP046314.1 | Gemella morbillorum |
| 123 | 2125798 | 2125983 | + | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 124 | 2806853 | 2807023 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 125 | 1138619 | 1138807 | - | NZ_CP011366.1 | Salinicoccus halodurans |
++ More..