Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01475 |
NCBI Accession ID | NC_003210.1 |
Organism | Listeria monocytogenes strain EGD |
Left | 1276892 |
Right | 1276999 |
Strand | - |
Nucleotide Sequence | TTGAAAAAAACAGAAAGTGAAAAACCACTTGTCATCAAAATTGTTATCAGCGTTCTCGTAGGTTTATTTTTACTTAATTTAATGCCATTTTTAGCGATTTTCGGCTAA |
Sequence | LKKTESEKPLVIKIVISVLVGLFLLNLMPFLAIFG |
Source of smORF | Literature |
Function | |
Pubmed ID | 30796087 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 35 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1276892 | 1276999 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
2 | 1261017 | 1261124 | - | NZ_LT906444.1 | Listeria welshimeri |
3 | 1190351 | 1190458 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
4 | 1307077 | 1307184 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
5 | 1714001 | 1714108 | + | NZ_LR134483.1 | Listeria grayi |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13545.8 | 0.8 | 4 | 1347.5 | opposite-strand | Crp-like helix-turn-helix domain |
2 | PF00027.31 | 0.8 | 4 | 1347.5 | opposite-strand | Cyclic nucleotide-binding domain |
3 | PF02588.17 | 1.0 | 5 | 197 | same-strand | Uncharacterised 5xTM membrane BCR, YitT family COG1284 |
4 | PF10035.11 | 1.0 | 5 | 197 | same-strand | Uncharacterized protein conserved in bacteria (DUF2179) |
5 | PF07702.15 | 0.8 | 4 | 312.0 | opposite-strand | UTRA domain |
6 | PF00392.23 | 0.8 | 4 | 312.0 | opposite-strand | Bacterial regulatory proteins, gntR family |
7 | PF00128.26 | 0.6 | 3 | 1057 | same-strand | Alpha amylase, catalytic domain |
8 | PF11941.10 | 0.6 | 3 | 1057 | same-strand | Domain of unknown function (DUF3459) |
9 | PF02378.20 | 0.8 | 4 | 2722.0 | same-strand | Phosphotransferase system, EIIC |
10 | PF00367.22 | 0.8 | 4 | 2722.0 | same-strand | phosphotransferase system, EIIB |
11 | PF00293.30 | 0.6 | 3 | 4321 | opposite-strand | NUDIX domain |