ProsmORF-pred
Result : EXP01465
Protein Information
Information Type Description
Protein name EXP01465
NCBI Accession ID BA000022.2
Organism Synechocystis sp. PCC 6803
Left 2775318
Right 2775608
Strand +
Nucleotide Sequence TTGATCATGGCTAATACAACTAAAGGAGCCGATGCCATTGACCAGGCGATCGCCGCTGGCATTGATTTTGATGGCAGTGCCATTCCCGAAGCCAAGCTGGAACTCTATCATCAGGTGATGGGCTTGGAAGCAGGTCGGCAACGCAGTGGGGTCAGTAATACCATGCGCTCCCGCATTGTCCGCATTGGAGCCAAACATATTGTCCAGGCAGAACTAGACCAAAAATTAATTGACGCTGGCTTTGCACCCCTCAAGGATAAAGAAATTGCTTTTTTCTATGGCGCTAAGTAG
Sequence LIMANTTKGADAIDQAIAAGIDFDGSAIPEAKLELYHQVMGLEAGRQRSGVSNTMRSRIVRIGAKHIVQAELDQKLIDAGFAPLKDKEIAFFYGAK
Source of smORF Protein-level
Function The ORF matches to the profile of pfam13319. Profile Description: Protein of unknown function (DUF4090). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length.
Pubmed ID 30796087
Domain CDD:404237
Functional Category Conserved domain based functional assignment
Uniprot ID
ORF Length (Amino Acid) 96
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 22
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1144079 1144384 + NC_019771.1 Anabaena cylindrica PCC 7122
2 42717 43019 + NZ_CP060822.1 Cylindrospermopsis curvispora GIHE-G1
3 1267160 1267429 - NC_019695.1 Chroococcidiopsis thermalis PCC 7203
4 4850810 4851115 - NZ_CP047242.1 Trichormus variabilis 0441
5 5626043 5626336 + NC_019751.1 Calothrix sp. PCC 6303
6 6745543 6745848 + NC_010628.1 Nostoc punctiforme PCC 73102
7 5010791 5011096 - NZ_CP054698.1 Nostoc edaphicum CCNP1411
8 2303152 2303457 - NZ_CP024785.1 Nostoc flagelliforme CCNUN1
9 3388569 3388874 - NZ_CP031941.1 Nostoc sphaeroides
10 5725233 5725523 - NC_009925.1 Acaryochloris marina MBIC11017
11 912293 912541 + NC_019693.1 Oscillatoria acuminata PCC 6304
12 2292626 2292907 - NC_019748.1 Stanieria cyanosphaera PCC 7437
13 5826364 5826669 - NC_019729.1 Oscillatoria nigro-viridis PCC 7112
14 1600458 1600760 + NC_019753.1 Crinalium epipsammum PCC 9333
15 1790770 1791060 - NC_011729.1 Gloeothece citriformis PCC 7424
16 6136082 6136366 - NZ_AP014638.1 Leptolyngbya boryana IAM M-101
17 4128011 4128250 - NC_010296.1 Microcystis aeruginosa NIES-843
18 3691570 3691878 + NC_019689.1 Pleurocapsa sp. PCC 7327
19 5184057 5184341 + NC_014501.1 Gloeothece verrucosa PCC 7822
20 2928309 2928590 + NC_019780.1 Dactylococcopsis salina PCC 8305
21 575367 575639 - NC_019675.1 Cyanobium gracile PCC 6307
22 1413396 1413668 - NC_005042.1 Prochlorococcus marinus subsp. marinus str. CCMP1375
++ More..