Result : EXP01452
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01452 |
| NCBI Accession ID | NC_017340.1 |
| Organism | Staphylococcus aureus 04-02981 |
| Left | 2608136 |
| Right | 2608429 |
| Strand | + |
| Nucleotide Sequence | TTGATATGTATGAGTAACCTTGAAATCAAACAAGGCGAGAACAAATTCTATATTGGTGATGATGAAAATAATGCTTTAGCTGAAATCACATACCGTTTTGTGGATAATAATGAAATTAACATTGATCATACAGGCGTATCTGATGAACTTGGTGGTCAAGGTGTTGGCAAAAAACTAGTTAAAGCAGTTGTTGAACACGCTCGAGAAAATCATTTAAAAATTATTGCCTCATGTTCATTTGCCAAACATATGTTAGAAAAAGAAGATTCATATCAAGATGTATATCTTGGTTAA |
| Sequence | LICMSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLVKAVVEHARENHLKIIASCSFAKHMLEKEDSYQDVYLG |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl17182. Profile Description: N-Acyltransferase superfamily: Various enyzmes that characteristicly catalyze the transfer of an acyl group to a substrate. This family of GCN5-related N-acetyl-transferases bind both CoA and acetyl-CoA. They are characterized by highly conserved glycine, a cysteine residue in the acetyl-CoA binding site near the acetyl group, their small size compared with other GNATs and a lack of of an obvious substrate-binding site. It is proposed that they transfer an acetyl group from acetyl-CoA to one or more unidentified aliphatic amines via an acetyl (cysteine) enzyme intermediate. The substrate might be another macromolecule. |
| Pubmed ID | 30796087 |
| Domain | CDD:418431 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 39
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2605727 | 2606020 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 2567166 | 2567459 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 2418150 | 2418431 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 1261683 | 1261964 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 5 | 504435 | 504716 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 6 | 454568 | 454810 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 7 | 1941065 | 1941355 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 8 | 1058243 | 1058524 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 9 | 1698202 | 1698444 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 10 | 522100 | 522381 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 11 | 417073 | 417354 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 12 | 2043434 | 2043715 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 13 | 484097 | 484375 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 14 | 2416598 | 2416876 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 15 | 434148 | 434426 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 16 | 2258314 | 2258592 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 17 | 555934 | 556212 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 18 | 1994562 | 1994840 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 19 | 222893 | 223177 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 20 | 392491 | 392775 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 21 | 1329821 | 1330099 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 22 | 2461240 | 2461518 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 23 | 11033 | 11308 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 24 | 507850 | 508128 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 25 | 247766 | 248038 | + | NZ_LN879430.1 | Herbinix luporum |
| 26 | 209338 | 209613 | + | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 27 | 823520 | 823798 | + | NZ_CP027770.1 | Staphylococcus felis |
| 28 | 3167746 | 3168024 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 29 | 3247089 | 3247364 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 30 | 65180 | 65452 | + | NZ_CP047361.1 | Macrococcus canis |
| 31 | 573640 | 573915 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 32 | 3359731 | 3360024 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 33 | 1023005 | 1023283 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 34 | 3739127 | 3739399 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 35 | 3846629 | 3846928 | + | NZ_CP009288.1 | Paenibacillus durus |
| 36 | 1318728 | 1318967 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 37 | 5091943 | 5092224 | + | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 38 | 4526976 | 4527257 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 39 | 6612820 | 6613131 | + | NZ_CP068595.1 | Paenibacillus sonchi |
++ More..