Result : EXP01443
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01443 |
| NCBI Accession ID | BA000022.2 |
| Organism | Synechocystis sp. PCC 6803 |
| Left | 3383577 |
| Right | 3383846 |
| Strand | - |
| Nucleotide Sequence | ATGGAAATTCAACTCATCAACATTGGCTTTGGCAATATTGTTTCTGGCAATCGGGTTGTTGCCATTGTCAGTCCAGAATCCGCTCCCATTAAGAGGATTATCAGCGATGCCAAGGAACGTAGTCAGTTAATTGATGCCACCTATGGCCGACGTACCAGGGCTGTGATCATTATGGACTCTAATCAGGTAATTCTTTCGGCTATTCAACCGGAAACCGTGGCTAACCGTTTTGTGGTGGATAAGGATTTTAAAGAAAATGCGAAAAAGTAA |
| Sequence | MEIQLINIGFGNIVSGNRVVAIVSPESAPIKRIISDAKERSQLIDATYGRRTRAVIIMDSNQVILSAIQPETVANRFVVDKDFKENAKK |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00898. Profile Description: Domain of unknown function (DUF370). hypothetical protein; Provisional |
| Pubmed ID | 30796087 |
| Domain | CDD:412637 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | B8HWL3 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 334
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5751190 | 5751456 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 2 | 110043 | 110309 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 3 | 3824685 | 3824951 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 4 | 681346 | 681612 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 5 | 5547922 | 5548188 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 6 | 4877514 | 4877780 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 7 | 3150536 | 3150802 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 8 | 1616602 | 1616868 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 9 | 4209928 | 4210194 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 10 | 5101156 | 5101422 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 11 | 3104897 | 3105163 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 12 | 2026028 | 2026291 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 13 | 3410332 | 3410598 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 14 | 2973493 | 2973759 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 15 | 5549978 | 5550244 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 16 | 2319310 | 2319576 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 17 | 567146 | 567409 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 18 | 1002854 | 1003105 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 19 | 1275279 | 1275545 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 20 | 2592450 | 2592716 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 21 | 1034178 | 1034447 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 22 | 1292207 | 1292473 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 23 | 1668547 | 1668798 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 24 | 1653428 | 1653700 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 25 | 5543729 | 5543974 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 26 | 1361933 | 1362220 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 27 | 1341887 | 1342174 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 28 | 1858761 | 1859033 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 29 | 2341814 | 2342086 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 30 | 3054617 | 3054886 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 31 | 2372551 | 2372814 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 32 | 1321116 | 1321376 | + | NZ_CP012024.1 | Bacillus smithii |
| 33 | 1667040 | 1667300 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 34 | 1843734 | 1844012 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 35 | 2488053 | 2488328 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 36 | 1353765 | 1354055 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 37 | 4996432 | 4996695 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 38 | 1351799 | 1352092 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 39 | 2942030 | 2942302 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 40 | 1463491 | 1463784 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 41 | 1108118 | 1108387 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 42 | 1166253 | 1166522 | - | NZ_LR134375.1 | Veillonella dispar |
| 43 | 2268102 | 2268362 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 44 | 1329633 | 1329896 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 45 | 2116318 | 2116581 | + | NZ_CP053989.1 | Niallia circulans |
| 46 | 345090 | 345374 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 47 | 1689282 | 1689551 | + | NZ_AP014924.1 | Limnochorda pilosa |
| 48 | 1431945 | 1432211 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 49 | 1720930 | 1721193 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 50 | 887306 | 887572 | + | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 51 | 1769518 | 1769787 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 52 | 2700808 | 2701068 | - | NZ_LS483476.1 | Lederbergia lentus |
| 53 | 2600791 | 2601054 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 54 | 1868597 | 1868875 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 55 | 1484528 | 1484755 | + | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 56 | 4043549 | 4043815 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 57 | 3365240 | 3365500 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 58 | 880313 | 880576 | - | NZ_CP029256.1 | Christensenella minuta |
| 59 | 2020150 | 2020413 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 60 | 2364481 | 2364750 | - | NZ_CP011937.1 | Bacillus velezensis |
| 61 | 1820032 | 1820301 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 62 | 1549069 | 1549338 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 63 | 1596396 | 1596665 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 64 | 1645750 | 1646019 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 65 | 1608212 | 1608481 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 66 | 1614542 | 1614811 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 67 | 344202 | 344471 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 68 | 1641672 | 1641941 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 69 | 1455588 | 1455854 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 70 | 2151249 | 2151515 | - | NZ_CP036259.1 | Sporomusa termitida |
| 71 | 1211050 | 1211319 | - | NZ_LR778174.1 | Veillonella parvula |
| 72 | 1791118 | 1791396 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 73 | 1747484 | 1747753 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 74 | 1770086 | 1770355 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 75 | 939655 | 939924 | + | NZ_LT906470.1 | Veillonella rodentium |
| 76 | 155484 | 155753 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 77 | 1543716 | 1543985 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 78 | 3775193 | 3775462 | - | NZ_CP043404.1 | Bacillus safensis |
| 79 | 2405657 | 2405920 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 80 | 1240567 | 1240836 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 81 | 224159 | 224428 | - | NZ_CP023671.1 | Clostridium septicum |
| 82 | 1356982 | 1357254 | + | NZ_CP043998.1 | Clostridium diolis |
| 83 | 2857010 | 2857285 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 84 | 2762956 | 2763219 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 85 | 1004699 | 1004968 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 86 | 2958544 | 2958804 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 87 | 2672055 | 2672315 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 88 | 1179586 | 1179891 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 89 | 2236592 | 2236897 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 90 | 2023523 | 2023786 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 91 | 2254111 | 2254383 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 92 | 4840861 | 4841121 | - | NZ_CP034437.1 | Paenibacillus albus |
| 93 | 4121566 | 4121826 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 94 | 1227201 | 1227473 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 95 | 2604584 | 2604847 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 96 | 2249270 | 2249542 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 97 | 1449491 | 1449775 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 98 | 1526746 | 1527030 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 99 | 1527107 | 1527391 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 100 | 2241243 | 2241512 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 101 | 1833347 | 1833619 | + | NZ_CP014176.1 | Clostridium argentinense |
| 102 | 2598420 | 2598695 | - | NZ_CP028842.1 | Clostridium botulinum |
| 103 | 6440324 | 6440584 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 104 | 854107 | 854370 | + | NC_013385.1 | Ammonifex degensii KC4 |
| 105 | 4273908 | 4274168 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 106 | 180531 | 180794 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 107 | 3119741 | 3120019 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 108 | 1156388 | 1156669 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 109 | 1531227 | 1531508 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 110 | 4454210 | 4454470 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 111 | 2632828 | 2633091 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 112 | 1809218 | 1809490 | + | NZ_CP040924.1 | Clostridium thermarum |
| 113 | 1523002 | 1523274 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 114 | 1581398 | 1581658 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 115 | 2302032 | 2302292 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 116 | 994211 | 994471 | + | NZ_CP033433.1 | Cohnella candidum |
| 117 | 98382 | 98642 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 118 | 476944 | 477204 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 119 | 2147565 | 2147825 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 120 | 5301570 | 5301830 | - | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 121 | 1795159 | 1795434 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 122 | 1122842 | 1123111 | + | NZ_CP030775.1 | Clostridium butyricum |
| 123 | 1148197 | 1148475 | + | NZ_CP020953.1 | Clostridium drakei |
| 124 | 4383369 | 4383629 | - | NZ_AP019400.1 | Cohnella abietis |
| 125 | 4188295 | 4188558 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 126 | 992098 | 992361 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 127 | 1440287 | 1440559 | - | NC_008593.1 | Clostridium novyi NT |
| 128 | 1410273 | 1410545 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 129 | 1018057 | 1018326 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 130 | 1202077 | 1202346 | - | NZ_CP016786.1 | Clostridium isatidis |
| 131 | 1536967 | 1537236 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 132 | 1877159 | 1877440 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 133 | 828827 | 829072 | + | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 134 | 1345526 | 1345798 | - | NZ_CP016379.1 | Anoxybacter fermentans |
| 135 | 1768129 | 1768374 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 136 | 1429832 | 1430092 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 137 | 1163981 | 1164250 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 138 | 1724702 | 1724971 | - | NZ_CP014204.2 | Clostridium baratii |
| 139 | 3719925 | 3720194 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 140 | 3588464 | 3588739 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 141 | 1352408 | 1352683 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 142 | 109332 | 109610 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 143 | 2130875 | 2131150 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 144 | 1070337 | 1070591 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 145 | 925863 | 926123 | + | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 146 | 2115186 | 2115461 | - | NZ_HG917868.1 | Clostridium bornimense |
| 147 | 3535512 | 3535772 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 148 | 1193022 | 1193282 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 149 | 4435162 | 4435422 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
| 150 | 2608673 | 2608933 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 151 | 1603487 | 1603747 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 152 | 4870032 | 4870292 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 153 | 1134011 | 1134271 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 154 | 2813692 | 2813952 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 155 | 5055133 | 5055393 | + | NZ_CP048429.1 | Paenibacillus jilunlii |
| 156 | 3125730 | 3125990 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 157 | 6076671 | 6076931 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 158 | 3493419 | 3493679 | + | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 159 | 4345479 | 4345739 | - | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 160 | 3602085 | 3602345 | + | NZ_CP009285.1 | Paenibacillus borealis |
| 161 | 2807468 | 2807749 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 162 | 1294516 | 1294779 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 163 | 3427076 | 3427339 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 164 | 1509640 | 1509930 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 165 | 2258852 | 2259121 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 166 | 1331000 | 1331260 | - | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 167 | 1403855 | 1404133 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 168 | 971655 | 971915 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 169 | 262004 | 262243 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 170 | 719184 | 719444 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 171 | 2453298 | 2453558 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 172 | 986894 | 987154 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 173 | 357619 | 357858 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 174 | 2973690 | 2973956 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 175 | 3392693 | 3392959 | + | NZ_CP021434.1 | Tumebacillus avium |
| 176 | 2243700 | 2243960 | + | NZ_CP021780.1 | Paenibacillus donghaensis |
| 177 | 6447290 | 6447550 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 178 | 1765907 | 1766167 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 179 | 2866401 | 2866661 | + | NZ_CP009288.1 | Paenibacillus durus |
| 180 | 1826135 | 1826401 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 181 | 1116184 | 1116444 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 182 | 843998 | 844273 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 183 | 1099479 | 1099760 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 184 | 676735 | 677010 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 185 | 2466318 | 2466587 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 186 | 1016057 | 1016329 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 187 | 2248346 | 2248609 | + | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 188 | 1171344 | 1171610 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 189 | 1625424 | 1625690 | - | NZ_CP034118.1 | Staphylospora marina |
| 190 | 2215935 | 2216213 | + | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 191 | 2174869 | 2175147 | - | NZ_CP009687.1 | Clostridium aceticum |
| 192 | 2422768 | 2423049 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 193 | 2275117 | 2275377 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 194 | 3207805 | 3208083 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 195 | 2274849 | 2275118 | - | NZ_CP046996.1 | Dehalobacter restrictus |
| 196 | 2227875 | 2228141 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 197 | 1570980 | 1571270 | - | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 198 | 106442 | 106699 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 199 | 2480405 | 2480665 | + | NZ_CP026363.1 | Brevibacillus agri |
| 200 | 1279538 | 1279822 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 201 | 1111249 | 1111503 | + | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 202 | 2147128 | 2147406 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 203 | 2354086 | 2354358 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 204 | 2797262 | 2797537 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 205 | 3337229 | 3337504 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 206 | 3946908 | 3947183 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 207 | 3854449 | 3854724 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 208 | 4128806 | 4129081 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 209 | 4942074 | 4942349 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 210 | 1187406 | 1187669 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 211 | 273284 | 273547 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 212 | 635255 | 635518 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 213 | 1386527 | 1386793 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 214 | 1625757 | 1626014 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 215 | 2007014 | 2007280 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 216 | 537813 | 538073 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 217 | 1402656 | 1402925 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 218 | 2795236 | 2795493 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 219 | 2977605 | 2977865 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 220 | 2820573 | 2820800 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 221 | 1246876 | 1247136 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 222 | 585588 | 585851 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 223 | 2185931 | 2186194 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 224 | 3941458 | 3941721 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 225 | 1400274 | 1400501 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 226 | 1126625 | 1126849 | + | NZ_HF545616.1 | Ruminococcus bicirculans |
| 227 | 103577 | 103861 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 228 | 337148 | 337432 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 229 | 1155680 | 1155946 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 230 | 2125528 | 2125791 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 231 | 56084 | 56350 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 232 | 1826692 | 1826973 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 233 | 2335243 | 2335515 | - | NZ_CP048436.1 | Flavonifractor plautii |
| 234 | 3310996 | 3311256 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 235 | 1477341 | 1477604 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 236 | 1524274 | 1524534 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 237 | 2655184 | 2655444 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 238 | 1772866 | 1773090 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 239 | 1697175 | 1697441 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 240 | 1732230 | 1732496 | - | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 241 | 1279143 | 1279409 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 242 | 338196 | 338462 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 243 | 1514878 | 1515102 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 244 | 1548827 | 1549093 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 245 | 1762971 | 1763231 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 246 | 592543 | 592803 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 247 | 1544870 | 1545130 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 248 | 1903912 | 1904175 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 249 | 1400069 | 1400347 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 250 | 1660357 | 1660617 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 251 | 2456210 | 2456473 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 252 | 2057634 | 2057915 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 253 | 2097865 | 2098137 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
| 254 | 2616624 | 2616887 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 255 | 1470910 | 1471173 | + | NZ_CP040336.1 | Bacillus luti |
| 256 | 3688770 | 3689033 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 257 | 3758324 | 3758587 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 258 | 3893315 | 3893578 | - | NC_011725.1 | Bacillus cereus B4264 |
| 259 | 3897601 | 3897864 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 260 | 1985698 | 1985949 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 261 | 1591712 | 1591972 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 262 | 330886 | 331104 | + | NZ_LT996885.1 | Dialister massiliensis |
| 263 | 916204 | 916422 | - | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 264 | 873897 | 874166 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 265 | 1152916 | 1153143 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 266 | 1016572 | 1016799 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 267 | 1146104 | 1146331 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 268 | 1461295 | 1461552 | - | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 269 | 4022180 | 4022440 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 270 | 2066820 | 2067074 | + | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 271 | 1281042 | 1281299 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 272 | 390180 | 390467 | + | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 273 | 1146583 | 1146837 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 274 | 78161 | 78439 | + | NZ_CP029462.1 | Megasphaera stantonii |
| 275 | 2387104 | 2387343 | - | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 276 | 1123407 | 1123670 | - | NC_014011.1 | Aminobacterium colombiense DSM 12261 |
| 277 | 8251516 | 8251800 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 278 | 1986039 | 1986284 | + | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 279 | 3509389 | 3509667 | + | NZ_CP061799.1 | Desulfonema limicola |
| 280 | 7312707 | 7312961 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 281 | 1909721 | 1909981 | + | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 282 | 7285974 | 7286228 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
| 283 | 1171445 | 1171726 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 284 | 4442056 | 4442340 | - | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 285 | 815477 | 815740 | + | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 286 | 840460 | 840717 | + | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 287 | 986614 | 986847 | - | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 288 | 3117834 | 3118052 | - | NZ_CP039126.1 | Blautia producta |
| 289 | 338075 | 338302 | + | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 290 | 69677 | 69922 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 291 | 1319144 | 1319365 | + | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 292 | 1550476 | 1550721 | - | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 293 | 2921612 | 2921887 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 294 | 2512789 | 2513058 | + | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 295 | 1387346 | 1387570 | + | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 296 | 164103 | 164339 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 297 | 903850 | 904104 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 298 | 2355443 | 2355697 | - | NZ_CP016757.1 | Cloacibacillus porcorum |
| 299 | 2107469 | 2107699 | - | NZ_CP030280.1 | Blautia argi |
| 300 | 364827 | 365093 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 301 | 2211288 | 2211545 | - | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 302 | 1850206 | 1850454 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 303 | 3517923 | 3518195 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 304 | 2097477 | 2097743 | + | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 305 | 464792 | 465049 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 306 | 2362422 | 2362643 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 307 | 4066390 | 4066644 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 308 | 1183691 | 1183915 | - | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 309 | 97467 | 97754 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
| 310 | 2516657 | 2516896 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 311 | 3746442 | 3746696 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 312 | 3283406 | 3283663 | + | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 313 | 996736 | 996990 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 314 | 2046652 | 2046888 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 315 | 2093172 | 2093435 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 316 | 99194 | 99418 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 317 | 2721810 | 2722064 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 318 | 912487 | 912705 | - | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 319 | 2776685 | 2776942 | - | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 320 | 2551152 | 2551391 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 321 | 4167659 | 4167877 | - | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 322 | 2300214 | 2300501 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 323 | 4366567 | 4366821 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 324 | 3114868 | 3115086 | - | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 325 | 207756 | 207995 | + | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 326 | 2518606 | 2518839 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 327 | 2425128 | 2425361 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 328 | 32101 | 32391 | - | NZ_CP006950.1 | Dehalococcoides mccartyi CG4 |
| 329 | 1258559 | 1258819 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 330 | 3683907 | 3684167 | + | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 331 | 346065 | 346283 | - | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
| 332 | 948838 | 949065 | - | NC_017094.1 | Leptospirillum ferrooxidans C2-3 |
| 333 | 869111 | 869350 | - | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 334 | 1170452 | 1170691 | - | NZ_CP028105.1 | Fusobacterium ulcerans |
| 335 | 470187 | 470420 | + | NC_015318.1 | Hippea maritima DSM 10411 |
| 336 | 1606293 | 1606529 | + | NZ_LR699011.1 | Roseburia hominis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP019698.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00625.23 | 0.95 | 318 | 10.0 | same-strand | Guanylate kinase |
| 2 | PF13238.8 | 0.67 | 223 | 12.0 | same-strand | AAA domain |
| 3 | PF03755.15 | 0.84 | 280 | 33.5 | same-strand | YicC-like family, N-terminal region |
| 4 | PF08340.13 | 0.84 | 280 | 33.5 | same-strand | Domain of unknown function (DUF1732) |
| 5 | PF01192.24 | 0.81 | 270 | 630.0 | same-strand | RNA polymerase Rpb6 |
| 6 | PF04127.17 | 0.71 | 236 | 897.0 | same-strand | DNA / pantothenate metabolism flavoprotein |
| 7 | PF02441.21 | 0.71 | 237 | 897 | same-strand | Flavoprotein |
| 8 | PF18074.3 | 0.6 | 202 | 2167.5 | same-strand | Primosomal protein N C-terminal domain |
| 9 | PF17764.3 | 0.62 | 208 | 2162.5 | same-strand | 3'DNA-binding domain (3'BD) |
| 10 | PF04851.17 | 0.6 | 202 | 2171.0 | same-strand | Type III restriction enzyme, res subunit |
| 11 | PF00270.31 | 0.61 | 203 | 2169 | same-strand | DEAD/DEAH box helicase |
| 12 | PF18319.3 | 0.61 | 203 | 2167 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
++ More..