Result : EXP01431
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01431 |
| NCBI Accession ID | NC_017340.1 |
| Organism | Staphylococcus aureus 04-02981 |
| Left | 1662592 |
| Right | 1662882 |
| Strand | - |
| Nucleotide Sequence | ATGCTTACTGGCAAACAAAAAAGATACTTAAGAAGTTTAGCACACAATATTGATCCGATTTTTCAAATTGGAAAAGGCGGTATCAACGAAAATATGATTAAACAAATAGATGATACGTTAGAAAACAGAGAATTGATTAAAGTACATGTACTACAAAATAACTTTGATGATAAAAAAGAATTAGCTGAAACATTAAGCGAAGCTACGCGTAGTGAATTAGTGCAAGTGATTGGATCTATGATAGTGATTTATAGAGAATCTAAAGAAAATAAAGAAATTGAATTGCCATAA |
| Sequence | MLTGKQKRYLRSLAHNIDPIFQIGKGGINENMIKQIDDTLENRELIKVHVLQNNFDDKKELAETLSEATRSELVQVIGSMIVIYRESKENKEIELP |
| Source of smORF | Protein-level |
| Function | RNA binding [GO:0003723] The ORF matches to the profile of cl00663. Profile Description: CRS1 / YhbY (CRM) domain. GFP fused to a single-domain CRM protein from maize localises to the nucleolus, suggesting that an analogous activity may have been retained in plants. A CRM domain containing protein in plant chloroplasts has been shown to function in group I and II intron splicing. In vitro experiments with an isolated maize CRM domain have shown it to have RNA binding activity. These and other results suggest that the CRM domain evolved in the context of ribosome function prior to the divergence of Archaea and Bacteria, that this function has been maintained in extant prokaryotes, and that the domain was recruited to serve as an RNA binding module during the evolution of plant genomes. YhbY has a fold similar to that of the C-terminal domain of translation initiation factor 3 (IF3C), which binds to 16S rRNA in the 30S ribosome. |
| Pubmed ID | 30796087 |
| Domain | CDD:412505 |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | P54454 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 253
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1607137 | 1607427 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1672578 | 1672868 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1595640 | 1595930 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 1271381 | 1271671 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 5 | 1331509 | 1331799 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 6 | 1978758 | 1979048 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 7 | 197498 | 197788 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 8 | 1231376 | 1231666 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 9 | 1269333 | 1269626 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 10 | 927596 | 927886 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 11 | 1239031 | 1239321 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 12 | 524244 | 524537 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 13 | 1078615 | 1078878 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 14 | 1317296 | 1317586 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 15 | 471600 | 471890 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 16 | 1473839 | 1474129 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 17 | 1675794 | 1676084 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 18 | 59398 | 59691 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 19 | 1410148 | 1410441 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 20 | 1120732 | 1121022 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 21 | 2039334 | 2039627 | - | NZ_CP027770.1 | Staphylococcus felis |
| 22 | 1418387 | 1418677 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 23 | 200582 | 200872 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 24 | 1119939 | 1120229 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 25 | 1215247 | 1215540 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 26 | 1038046 | 1038336 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 27 | 1285892 | 1286182 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 28 | 2068761 | 2069051 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 29 | 1129282 | 1129572 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 30 | 1340819 | 1341112 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 31 | 1075677 | 1075967 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 32 | 4315538 | 4315831 | - | NC_011725.1 | Bacillus cereus B4264 |
| 33 | 4145575 | 4145868 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 34 | 1408436 | 1408726 | + | NZ_CP011937.1 | Bacillus velezensis |
| 35 | 2591219 | 2591509 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 36 | 4354596 | 4354898 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 37 | 3150608 | 3150901 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 38 | 3613275 | 3613565 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 39 | 3664748 | 3665038 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 40 | 1763886 | 1764179 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 41 | 2652767 | 2653057 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 42 | 2813815 | 2814105 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 43 | 320709 | 321002 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 44 | 1424638 | 1424931 | - | NZ_CP047361.1 | Macrococcus canis |
| 45 | 2612705 | 2612995 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 46 | 2517771 | 2518061 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 47 | 2503332 | 2503622 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 48 | 2644346 | 2644636 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 49 | 672647 | 672937 | + | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 50 | 3438679 | 3438969 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 51 | 2076358 | 2076648 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 52 | 2516442 | 2516732 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 53 | 3100924 | 3101214 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 54 | 1052861 | 1053154 | + | NZ_CP040336.1 | Bacillus luti |
| 55 | 4181112 | 4181405 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 56 | 3337807 | 3338103 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 57 | 3392024 | 3392314 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 58 | 1412273 | 1412563 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 59 | 2440957 | 2441247 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 60 | 2087008 | 2087310 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 61 | 1586189 | 1586479 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 62 | 2927324 | 2927614 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 63 | 441534 | 441833 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 64 | 2309149 | 2309442 | - | NZ_CP012024.1 | Bacillus smithii |
| 65 | 5592118 | 5592414 | - | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 66 | 1417151 | 1417444 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 67 | 2158292 | 2158585 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 68 | 1540381 | 1540674 | - | NZ_CP054482.1 | Macrococcus bohemicus |
| 69 | 791008 | 791301 | + | NZ_CP021780.1 | Paenibacillus donghaensis |
| 70 | 482692 | 482988 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 71 | 1837441 | 1837737 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 72 | 6773178 | 6773471 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 73 | 1297015 | 1297308 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 74 | 3438607 | 3438897 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 75 | 1274947 | 1275240 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 76 | 2266180 | 2266470 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 77 | 2113250 | 2113543 | + | NZ_CP009285.1 | Paenibacillus borealis |
| 78 | 4129635 | 4129925 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 79 | 1487232 | 1487522 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 80 | 4341559 | 4341858 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 81 | 3036194 | 3036484 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 82 | 2338977 | 2339267 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 83 | 2947885 | 2948175 | + | NZ_CP043404.1 | Bacillus safensis |
| 84 | 2109693 | 2109986 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 85 | 2274730 | 2275023 | + | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 86 | 4176555 | 4176845 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 87 | 4006368 | 4006661 | + | NZ_CP048429.1 | Paenibacillus jilunlii |
| 88 | 3992310 | 3992603 | + | NZ_CP068595.1 | Paenibacillus sonchi |
| 89 | 2594748 | 2595041 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 90 | 1398983 | 1399273 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 91 | 4400134 | 4400424 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 92 | 1580196 | 1580486 | - | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 93 | 1632462 | 1632752 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 94 | 1134113 | 1134403 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 95 | 1144943 | 1145233 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 96 | 1862511 | 1862804 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 97 | 879815 | 880108 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 98 | 759869 | 760159 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 99 | 102581 | 102871 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 100 | 1309211 | 1309504 | + | NZ_CP012502.1 | Bacillus beveridgei |
| 101 | 2556332 | 2556637 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 102 | 2556453 | 2556746 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 103 | 1737009 | 1737302 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 104 | 1826984 | 1827220 | + | NZ_CP009288.1 | Paenibacillus durus |
| 105 | 2807729 | 2808019 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 106 | 1653252 | 1653545 | + | NZ_LS483476.1 | Lederbergia lentus |
| 107 | 1662526 | 1662819 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 108 | 2674061 | 2674351 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 109 | 3835797 | 3836093 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 110 | 1203839 | 1204129 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 111 | 2553611 | 2553901 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 112 | 1983097 | 1983390 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 113 | 1390285 | 1390575 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 114 | 1892893 | 1893183 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 115 | 3463474 | 3463761 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 116 | 1080314 | 1080604 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 117 | 1451000 | 1451290 | + | NZ_CP016538.2 | Planococcus maritimus |
| 118 | 1461004 | 1461294 | + | NZ_CP059540.1 | Planococcus maritimus |
| 119 | 2314047 | 2314340 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 120 | 2787933 | 2788223 | + | NZ_CP034437.1 | Paenibacillus albus |
| 121 | 2908674 | 2908970 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 122 | 4025674 | 4025964 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 123 | 3491375 | 3491668 | - | NZ_CP053989.1 | Niallia circulans |
| 124 | 2969050 | 2969340 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 125 | 4339249 | 4339545 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 126 | 2441825 | 2442115 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 127 | 1798324 | 1798617 | + | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 128 | 2569506 | 2569799 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 129 | 3385316 | 3385606 | - | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 130 | 738594 | 738887 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 131 | 2525860 | 2526150 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 132 | 3420256 | 3420546 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 133 | 750121 | 750420 | + | NZ_CP033433.1 | Cohnella candidum |
| 134 | 1343071 | 1343364 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 135 | 1349379 | 1349678 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 136 | 1747678 | 1747911 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 137 | 4910691 | 4910984 | - | NZ_CP021434.1 | Tumebacillus avium |
| 138 | 1815866 | 1816156 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 139 | 789580 | 789870 | + | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 140 | 3101123 | 3101425 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 141 | 1553189 | 1553491 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 142 | 1622281 | 1622574 | + | NZ_CP022657.1 | Tumebacillus algifaecis |
| 143 | 2325163 | 2325453 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 144 | 848220 | 848510 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 145 | 2044503 | 2044796 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 146 | 4653925 | 4654227 | - | NZ_AP019400.1 | Cohnella abietis |
| 147 | 2012874 | 2013164 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 148 | 1626927 | 1627217 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 149 | 557377 | 557667 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 150 | 1575753 | 1576052 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 151 | 2571851 | 2572144 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 152 | 5172309 | 5172605 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 153 | 2078735 | 2079031 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 154 | 187291 | 187581 | - | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 155 | 3886305 | 3886595 | - | NZ_CP026363.1 | Brevibacillus agri |
| 156 | 1553075 | 1553377 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 157 | 1402355 | 1402654 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 158 | 793053 | 793343 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 159 | 3276462 | 3276767 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 160 | 1457174 | 1457473 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 161 | 2860609 | 2860899 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 162 | 1971105 | 1971401 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 163 | 3115924 | 3116214 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 164 | 2841436 | 2841726 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 165 | 4733202 | 4733492 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
| 166 | 1950828 | 1951118 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 167 | 1424318 | 1424617 | + | NZ_CP016540.2 | Planococcus versutus |
| 168 | 2123831 | 2124121 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 169 | 285192 | 285491 | - | NZ_CP013661.2 | Planococcus kocurii |
| 170 | 1497630 | 1497929 | + | NZ_CP019401.1 | Planococcus faecalis |
| 171 | 513221 | 513520 | + | NZ_LR134484.1 | Gemella haemolysans |
| 172 | 1340478 | 1340768 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 173 | 1892828 | 1893118 | + | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 174 | 2129335 | 2129628 | - | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 175 | 3903019 | 3903285 | - | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 176 | 1516872 | 1517162 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 177 | 428954 | 429253 | - | NZ_CP046314.1 | Gemella morbillorum |
| 178 | 5620577 | 5620873 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 179 | 1062148 | 1062438 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 180 | 3147885 | 3148178 | - | NZ_CP028842.1 | Clostridium botulinum |
| 181 | 1787697 | 1787990 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 182 | 1462179 | 1462472 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 183 | 816562 | 816855 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 184 | 3381354 | 3381647 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 185 | 3324067 | 3324357 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 186 | 1444442 | 1444735 | - | NZ_LR134483.1 | Listeria grayi |
| 187 | 4384744 | 4385037 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 188 | 2670158 | 2670451 | - | NZ_CP053187.1 | Turicibacter sanguinis |
| 189 | 3726483 | 3726776 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 190 | 1380477 | 1380770 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 191 | 1902520 | 1902810 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 192 | 3396096 | 3396389 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 193 | 1742269 | 1742562 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 194 | 4597203 | 4597496 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 195 | 2979598 | 2979891 | - | NZ_CP014176.1 | Clostridium argentinense |
| 196 | 2541126 | 2541419 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 197 | 619922 | 620212 | + | NZ_CP046996.1 | Dehalobacter restrictus |
| 198 | 3089652 | 3089924 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 199 | 3080023 | 3080316 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 200 | 1077763 | 1078056 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 201 | 1555335 | 1555625 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 202 | 1403363 | 1403656 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 203 | 91624 | 91893 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 204 | 1498343 | 1498633 | - | NZ_LT906444.1 | Listeria welshimeri |
| 205 | 1176655 | 1176942 | - | NZ_LR134524.1 | Peptoniphilus harei |
| 206 | 1433829 | 1434119 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 207 | 2043165 | 2043461 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 208 | 828810 | 829121 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 209 | 3360535 | 3360828 | - | NC_014393.1 | Clostridium cellulovorans 743B |
| 210 | 1521243 | 1521533 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 211 | 88509 | 88799 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 212 | 1280287 | 1280580 | + | NZ_CP040924.1 | Clostridium thermarum |
| 213 | 2352913 | 2353203 | - | NZ_CP016786.1 | Clostridium isatidis |
| 214 | 602204 | 602449 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 215 | 4226085 | 4226378 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 216 | 559190 | 559486 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 217 | 2375214 | 2375510 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 218 | 1355365 | 1355673 | - | NZ_LS483306.1 | Enterococcus cecorum |
| 219 | 2982047 | 2982337 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 220 | 2075814 | 2076059 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 221 | 1033109 | 1033378 | + | NZ_LN879430.1 | Herbinix luporum |
| 222 | 1028718 | 1029005 | - | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 223 | 2579415 | 2579726 | - | NZ_CP023011.2 | Enterococcus hirae |
| 224 | 327099 | 327389 | + | NZ_CP070062.1 | Coprococcus comes |
| 225 | 1529314 | 1529625 | + | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 226 | 3154534 | 3154779 | + | NZ_CP022464.2 | Enterocloster bolteae |
| 227 | 1645762 | 1646049 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 228 | 1702634 | 1702924 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 229 | 1850711 | 1851022 | - | NZ_CP065211.1 | Enterococcus lactis |
| 230 | 1087162 | 1087449 | + | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 231 | 2348171 | 2348476 | - | NZ_CP027286.1 | Clostridium chauvoei |
| 232 | 1426735 | 1427022 | + | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 233 | 612778 | 613095 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 234 | 2329094 | 2329396 | + | NZ_CP023671.1 | Clostridium septicum |
| 235 | 677255 | 677557 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 236 | 1283666 | 1283977 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 237 | 1230268 | 1230579 | + | NZ_AP022822.1 | Enterococcus saigonensis |
| 238 | 1734527 | 1734838 | - | NZ_CP023074.1 | Enterococcus thailandicus |
| 239 | 3511126 | 3511437 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 240 | 2651870 | 2652172 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 241 | 633113 | 633376 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 242 | 1887541 | 1887831 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 243 | 2505592 | 2505885 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 244 | 2144843 | 2145103 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 245 | 2089384 | 2089635 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 246 | 923578 | 923862 | - | NZ_AP019711.1 | Amedibacterium intestinale |
| 247 | 960766 | 961047 | + | NZ_CP012047.1 | Tetragenococcus halophilus |
| 248 | 2816376 | 2816666 | + | NZ_CP039126.1 | Blautia producta |
| 249 | 1335561 | 1335851 | + | NZ_CP030280.1 | Blautia argi |
| 250 | 2821452 | 2821712 | - | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 251 | 2498989 | 2499279 | - | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 252 | 2248448 | 2248702 | + | NZ_AP012331.1 | Bifidobacterium scardovii JCM 12489 = DSM 13734 |
| 253 | 1943686 | 1944009 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 254 | 1313189 | 1313494 | - | NZ_CP025199.1 | Bifidobacterium pseudocatenulatum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13649.8 | 0.77 | 194 | 1512 | same-strand | Methyltransferase domain |
| 2 | PF08241.14 | 0.77 | 194 | 1512 | same-strand | Methyltransferase domain |
| 3 | PF08242.14 | 0.77 | 194 | 1512 | same-strand | Methyltransferase domain |
| 4 | PF13489.8 | 0.69 | 174 | 1511.0 | same-strand | Methyltransferase domain |
| 5 | PF02410.17 | 0.86 | 218 | 1164 | same-strand | Ribosomal silencing factor during starvation |
| 6 | PF01966.24 | 0.95 | 240 | 588 | same-strand | HD domain |
| 7 | PF01467.28 | 0.93 | 236 | 16.0 | same-strand | Cytidylyltransferase-like |
| 8 | PF08501.13 | 0.69 | 175 | 3.5 | same-strand | Shikimate dehydrogenase substrate binding domain |
| 9 | PF18317.3 | 0.68 | 171 | 4.0 | same-strand | Shikimate 5'-dehydrogenase C-terminal domain |
++ More..