Result : EXP01419
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01419 |
| NCBI Accession ID | NC_017381.1 |
| Organism | Helicobacter pylori 2018 |
| Left | 1437201 |
| Right | 1437470 |
| Strand | + |
| Nucleotide Sequence | ATGATAGAATTTAGCGATGAAGATTTACAAAAACCGGTCCGTATTGTAATAGAAAAAATCCGCCCTTACTTGCTCAAAGATGGCGGTAATATTGAAGTGCTTGGGGTGAAAAGCATGAAAATTTATGTGGCTTTAGAGGGAGCGTGTAAGACTTGCTCTAGCAGTAAAATCACTCTAAAAAATGTCATTGAAAGGCAGCTTAAAATGGACATTCACCCTAATTTAGAAGTGGTGTGTTTAGAAAACGCTAAGGAGTTTGATAAGCTTTAA |
| Sequence | MIEFSDEDLQKPVRIVIEKIRPYLLKDGGNIEVLGVKSMKIYVALEGACKTCSSSKITLKNVIERQLKMDIHPNLEVVCLENAKEFDKL |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl29515. Profile Description: NifU-like domain. This is an alignment of the carboxy-terminal domain. This is the only common region between the NifU protein from nitrogen-fixing bacteria and rhodobacterial species. The biochemical function of NifU is unknown. |
| Pubmed ID | 30796087 |
| Domain | CDD:421844 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 51
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1524131 | 1524400 | + | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 1528061 | 1528330 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 3 | 917258 | 917527 | + | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 4 | 732626 | 732904 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 5 | 2317245 | 2317520 | - | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 6 | 1602988 | 1603215 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 7 | 1722643 | 1722918 | - | NZ_CP012541.1 | Campylobacter concisus |
| 8 | 1343736 | 1344014 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 9 | 1788093 | 1788311 | - | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 10 | 1020775 | 1021035 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 11 | 1576309 | 1576584 | - | NZ_CP053842.1 | Campylobacter corcagiensis |
| 12 | 1401692 | 1401964 | + | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 13 | 1128275 | 1128544 | - | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 14 | 1573994 | 1574260 | - | NZ_CP053831.1 | Campylobacter mucosalis |
| 15 | 1840966 | 1841271 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 16 | 2010947 | 2011216 | - | NZ_CP012544.1 | Campylobacter showae |
| 17 | 255829 | 256101 | + | NZ_CP020478.1 | Campylobacter helveticus |
| 18 | 892264 | 892485 | + | NZ_LN907858.1 | Helicobacter typhlonius |
| 19 | 898698 | 898919 | + | NZ_LN907858.1 | Helicobacter typhlonius |
| 20 | 905132 | 905353 | + | NZ_LN907858.1 | Helicobacter typhlonius |
| 21 | 207891 | 208166 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 22 | 272819 | 273094 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 23 | 1821532 | 1821801 | - | NZ_CP053826.1 | Campylobacter curvus |
| 24 | 331292 | 331567 | + | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 25 | 1375754 | 1375999 | + | NZ_CP063087.1 | Helicobacter winghamensis |
| 26 | 1691711 | 1691977 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 27 | 1564854 | 1565126 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 28 | 1428385 | 1428603 | - | NZ_CP014991.1 | Helicobacter himalayensis |
| 29 | 1772247 | 1772522 | - | NZ_CP053841.1 | Campylobacter blaseri |
| 30 | 859651 | 859920 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 31 | 545238 | 545516 | + | NZ_CP035928.1 | Malaciobacter pacificus |
| 32 | 1314482 | 1314754 | - | NZ_CP031611.1 | Campylobacter hepaticus |
| 33 | 168881 | 169159 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 34 | 92014 | 92283 | + | NZ_CP012543.1 | Campylobacter rectus |
| 35 | 1218836 | 1219108 | - | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 36 | 222627 | 222899 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 37 | 670840 | 671118 | + | NZ_CP032097.1 | Arcobacter ellisii |
| 38 | 1465302 | 1465577 | - | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 39 | 879909 | 880184 | + | NZ_CP054051.1 | Aliarcobacter cibarius |
| 40 | 392904 | 393179 | + | NZ_CP036246.2 | [Arcobacter] porcinus |
| 41 | 651007 | 651285 | + | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 42 | 568875 | 569153 | + | NZ_CP030944.1 | Arcobacter aquimarinus |
| 43 | 558541 | 558819 | + | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 44 | 653633 | 653911 | + | NZ_CP053833.1 | Arcobacter cloacae |
| 45 | 1421776 | 1422051 | - | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 46 | 645727 | 646002 | + | NZ_CP053837.1 | Aliarcobacter faecis |
| 47 | 653097 | 653375 | + | NZ_CP053835.1 | Arcobacter defluvii |
| 48 | 165105 | 165383 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 49 | 787327 | 787605 | + | NZ_CP053840.1 | Arcobacter venerupis |
| 50 | 1972118 | 1972399 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 51 | 2427372 | 2427653 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 52 | 2584909 | 2585190 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 53 | 433793 | 434065 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017379.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08245.14 | 1.0 | 51 | 576 | same-strand | Mur ligase middle domain |
| 2 | PF02875.23 | 1.0 | 51 | 576 | same-strand | Mur ligase family, glutamate ligase domain |
++ More..