Result : EXP01415
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01415 |
| NCBI Accession ID | NZ_CP009472.1 |
| Organism | Lactococcus lactis strain AI06 |
| Left | 911603 |
| Right | 911866 |
| Strand | + |
| Nucleotide Sequence | ATGACTAAAGTACGTGTTTACGTGGCTTACAAAGCCTCAATTCTCGACCCTCAAGCCCAAGCGATTAAAGCGGCAACTCATAAAATGGGTTATCAAGAAGTTACAGAATTAAATGTTGGAAAATTTTTCGATTTTGAATTTGATGCAGAAGCTGAGATTGCTCGCGCAAAAGCAATTGAAATTGCCAATGAATTGTTGGCAAATCCAAATATGGAAACTTATAAAGTTGAAATTTTGAATGAACAAAGCGAAGGAGCTAATTAA |
| Sequence | MTKVRVYVAYKASILDPQAQAIKAATHKMGYQEVTELNVGKFFDFEFDAEAEIARAKAIEIANELLANPNMETYKVEILNEQSEGAN |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00789. Profile Description: Phosphoribosylformylglycinamidine (FGAM) synthase. phosphoribosylformylglycinamidine synthase subunit PurS; Reviewed |
| Pubmed ID | 30796087 |
| Domain | CDD:412569 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1581956 | 1582222 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 2 | 1420416 | 1420679 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
| 3 | 1178173 | 1178415 | + | NZ_CP065637.1 | Lactococcus garvieae |
| 4 | 448934 | 449179 | + | NZ_CP032627.1 | Lactococcus allomyrinae |
| 5 | 1548856 | 1549107 | - | NZ_CP017267.1 | Vagococcus teuberi |
| 6 | 1643678 | 1643932 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 7 | 1691106 | 1691360 | - | NZ_CP023074.1 | Enterococcus thailandicus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_022369.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13522.8 | 0.86 | 6 | 2889.5 | same-strand | Glutamine amidotransferase domain |
| 2 | PF13537.8 | 0.86 | 6 | 2889.5 | same-strand | Glutamine amidotransferase domain |
| 3 | PF02769.24 | 1.0 | 7 | 854 | same-strand | AIR synthase related protein, C-terminal domain |
| 4 | PF00586.26 | 1.0 | 7 | 854 | same-strand | AIR synthase related protein, N-terminal domain |
| 5 | PF18072.3 | 1.0 | 7 | 683 | same-strand | Formylglycinamide ribonucleotide amidotransferase linker domain |
| 6 | PF13507.8 | 1.0 | 7 | 0 | same-strand | CobB/CobQ-like glutamine amidotransferase domain |
| 7 | PF01259.20 | 1.0 | 7 | 22 | same-strand | SAICAR synthetase |
++ More..