Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01411 |
NCBI Accession ID | NC_017340.1 |
Organism | Staphylococcus aureus 04-02981 |
Left | 1708375 |
Right | 1708635 |
Strand | - |
Nucleotide Sequence | ATGCAATTTTCATTACTAATATATATAGTCGTAATTTTTGCGGTTATGTATTTCTTGATGATCAGACCACAACAAAAACGTGCGAAACAGCATCGTGAGTTGATTAATAACATTCAATCTGGTCAAAGAATTACAACTATTGGTGGTATTAAAGGTACTGTTAAAGCAGTAGATGAAACAACTGTTGTTATTACAGTTAATGGTCATGGTACTGAATTAACTTTCGAAAAACCTGCTATTAAACAAGTTGACCCTTCATAA |
Sequence | MQFSLLIYIVVIFAVMYFLMIRPQQKRAKQHRELINNIQSGQRITTIGGIKGTVKAVDETTVVITVNGHGTELTFEKPAIKQVDPS |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl00806. Profile Description: Preprotein translocase subunit. While this protein is part of the preprotein translocase in Escherichia coli, it is not essential for viability or protein secretion. The N-terminus region contains a predicted membrane-spanning region followed by a region consisting almost entirely of residues with charged (acidic, basic, or zwitterionic) side chains. This small protein is about 100 residues in length, and is restricted to bacteria; however, this protein is absent from some lineages, including spirochetes and Mycoplasmas. [Protein fate, Protein and peptide secretion and trafficking] |
Pubmed ID | 30796087 |
Domain | CDD:412579 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 86 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1652336 | 1652596 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 1716821 | 1717081 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
3 | 1289753 | 1289968 | + | NZ_AP018587.1 | Staphylococcus caprae |
4 | 2110229 | 2110489 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
5 | 159974 | 160234 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
6 | 1639781 | 1640041 | - | NZ_LT906460.1 | Staphylococcus simiae |
7 | 1226180 | 1226440 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
8 | 1312885 | 1313145 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
9 | 968936 | 969151 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
10 | 1938282 | 1938521 | + | NZ_CP033732.1 | Staphylococcus hominis |
11 | 1022137 | 1022352 | + | NZ_LT906464.1 | Staphylococcus muscae |
12 | 102566 | 102811 | - | NZ_CP020773.1 | Staphylococcus lutrae |
13 | 1085708 | 1085971 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
14 | 1298876 | 1299091 | + | NZ_CP008747.1 | Staphylococcus hyicus |
15 | 1163717 | 1163980 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
16 | 994378 | 994641 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
17 | 2081598 | 2081813 | - | NZ_CP027770.1 | Staphylococcus felis |
18 | 1256961 | 1257176 | - | NZ_CP045927.1 | Staphylococcus agnetis |
19 | 1195817 | 1196077 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
20 | 1517067 | 1517327 | - | NZ_CP013114.1 | Staphylococcus equorum |
21 | 1272442 | 1272702 | + | NZ_CP008724.1 | Staphylococcus xylosus |
22 | 1189724 | 1189984 | + | NZ_LR134242.1 | Staphylococcus warneri |
23 | 239242 | 239502 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
24 | 1079917 | 1080177 | + | NZ_CP065712.1 | Staphylococcus auricularis |
25 | 1243488 | 1243703 | + | NZ_CP064056.1 | Staphylococcus lloydii |
26 | 1451855 | 1452070 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
27 | 428362 | 428622 | + | NZ_CP018199.1 | Staphylococcus succinus |
28 | 1383191 | 1383406 | + | NZ_CP018776.1 | Staphylococcus condimenti |
29 | 1711034 | 1711249 | - | NZ_CP033460.1 | Staphylococcus debuckii |
30 | 1464415 | 1464672 | - | NZ_CP047361.1 | Macrococcus canis |
31 | 572455 | 572664 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
32 | 283183 | 283440 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
33 | 1321452 | 1321679 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
34 | 1860185 | 1860448 | - | NZ_CP008876.1 | Terribacillus goriensis |
35 | 2323811 | 2324026 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
36 | 1026610 | 1026825 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02580.18 | 0.83 | 30 | 8144.0 | same-strand | D-Tyr-tRNA(Tyr) deacylase |
2 | PF13328.8 | 0.83 | 30 | 5939.5 | same-strand | HD domain |
3 | PF04607.19 | 0.83 | 30 | 5939.5 | same-strand | Region found in RelA / SpoT proteins |
4 | PF02824.23 | 0.83 | 30 | 5939.5 | same-strand | TGS domain |
5 | PF13291.8 | 0.86 | 31 | 5682 | same-strand | ACT domain |
6 | PF01966.24 | 0.83 | 30 | 5939.5 | same-strand | HD domain |
7 | PF19296.1 | 0.83 | 30 | 5939.5 | same-strand | Domain of unknown function (DUF5913) |
8 | PF01842.27 | 0.67 | 24 | 5908 | same-strand | ACT domain |
9 | PF10141.11 | 0.89 | 32 | 2752.0 | same-strand | Single-strand DNA-specific exonuclease, C terminal domain |
10 | PF17768.3 | 0.89 | 32 | 2752.0 | same-strand | RecJ OB domain |
11 | PF02272.21 | 0.89 | 32 | 2752.0 | same-strand | DHHA1 domain |
12 | PF01368.22 | 0.89 | 32 | 2752.0 | same-strand | DHH family |
13 | PF02355.18 | 0.94 | 34 | 275.5 | same-strand | Protein export membrane protein |
14 | PF07549.16 | 0.92 | 33 | 275 | same-strand | SecD/SecF GG Motif |
15 | PF01702.20 | 1.0 | 36 | 26.0 | same-strand | Queuine tRNA-ribosyltransferase |
16 | PF02547.17 | 1.0 | 36 | 1183.5 | same-strand | Queuosine biosynthesis protein |
17 | PF05496.14 | 1.0 | 36 | 2210.5 | same-strand | Holliday junction DNA helicase RuvB P-loop domain |
18 | PF17864.3 | 1.0 | 36 | 2210.5 | same-strand | RuvB AAA lid domain |
19 | PF05491.15 | 1.0 | 36 | 2210.5 | same-strand | RuvB C-terminal winged helix domain |
20 | PF00004.31 | 1.0 | 36 | 2210.5 | same-strand | ATPase family associated with various cellular activities (AAA) |
21 | PF07728.16 | 1.0 | 36 | 2210.5 | same-strand | AAA domain (dynein-related subfamily) |
22 | PF01330.23 | 1.0 | 36 | 3248.0 | same-strand | RuvA N terminal domain |
23 | PF14520.8 | 1.0 | 36 | 3248.0 | same-strand | Helix-hairpin-helix domain |
24 | PF07499.15 | 1.0 | 36 | 3248.0 | same-strand | RuvA, C-terminal domain |