Result : EXP01411
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01411 |
| NCBI Accession ID | NC_017340.1 |
| Organism | Staphylococcus aureus 04-02981 |
| Left | 1708375 |
| Right | 1708635 |
| Strand | - |
| Nucleotide Sequence | ATGCAATTTTCATTACTAATATATATAGTCGTAATTTTTGCGGTTATGTATTTCTTGATGATCAGACCACAACAAAAACGTGCGAAACAGCATCGTGAGTTGATTAATAACATTCAATCTGGTCAAAGAATTACAACTATTGGTGGTATTAAAGGTACTGTTAAAGCAGTAGATGAAACAACTGTTGTTATTACAGTTAATGGTCATGGTACTGAATTAACTTTCGAAAAACCTGCTATTAAACAAGTTGACCCTTCATAA |
| Sequence | MQFSLLIYIVVIFAVMYFLMIRPQQKRAKQHRELINNIQSGQRITTIGGIKGTVKAVDETTVVITVNGHGTELTFEKPAIKQVDPS |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00806. Profile Description: Preprotein translocase subunit. While this protein is part of the preprotein translocase in Escherichia coli, it is not essential for viability or protein secretion. The N-terminus region contains a predicted membrane-spanning region followed by a region consisting almost entirely of residues with charged (acidic, basic, or zwitterionic) side chains. This small protein is about 100 residues in length, and is restricted to bacteria; however, this protein is absent from some lineages, including spirochetes and Mycoplasmas. [Protein fate, Protein and peptide secretion and trafficking] |
| Pubmed ID | 30796087 |
| Domain | CDD:412579 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 36
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1652336 | 1652596 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1716821 | 1717081 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1289753 | 1289968 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 4 | 2110229 | 2110489 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 5 | 159974 | 160234 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 6 | 1639781 | 1640041 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 7 | 1226180 | 1226440 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 8 | 1312885 | 1313145 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 9 | 968936 | 969151 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 10 | 1938282 | 1938521 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 11 | 1022137 | 1022352 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 12 | 102566 | 102811 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 13 | 1085708 | 1085971 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 14 | 1298876 | 1299091 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 15 | 1163717 | 1163980 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 16 | 994378 | 994641 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 17 | 2081598 | 2081813 | - | NZ_CP027770.1 | Staphylococcus felis |
| 18 | 1256961 | 1257176 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 19 | 1195817 | 1196077 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 20 | 1517067 | 1517327 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 21 | 1272442 | 1272702 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 22 | 1189724 | 1189984 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 23 | 239242 | 239502 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 24 | 1079917 | 1080177 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 25 | 1243488 | 1243703 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 26 | 1451855 | 1452070 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 27 | 428362 | 428622 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 28 | 1383191 | 1383406 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 29 | 1711034 | 1711249 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 30 | 1464415 | 1464672 | - | NZ_CP047361.1 | Macrococcus canis |
| 31 | 572455 | 572664 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 32 | 283183 | 283440 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 33 | 1321452 | 1321679 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 34 | 1860185 | 1860448 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 35 | 2323811 | 2324026 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 36 | 1026610 | 1026825 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02580.18 | 0.83 | 30 | 8144.0 | same-strand | D-Tyr-tRNA(Tyr) deacylase |
| 2 | PF13328.8 | 0.83 | 30 | 5939.5 | same-strand | HD domain |
| 3 | PF04607.19 | 0.83 | 30 | 5939.5 | same-strand | Region found in RelA / SpoT proteins |
| 4 | PF02824.23 | 0.83 | 30 | 5939.5 | same-strand | TGS domain |
| 5 | PF13291.8 | 0.86 | 31 | 5682 | same-strand | ACT domain |
| 6 | PF01966.24 | 0.83 | 30 | 5939.5 | same-strand | HD domain |
| 7 | PF19296.1 | 0.83 | 30 | 5939.5 | same-strand | Domain of unknown function (DUF5913) |
| 8 | PF01842.27 | 0.67 | 24 | 5908 | same-strand | ACT domain |
| 9 | PF10141.11 | 0.89 | 32 | 2752.0 | same-strand | Single-strand DNA-specific exonuclease, C terminal domain |
| 10 | PF17768.3 | 0.89 | 32 | 2752.0 | same-strand | RecJ OB domain |
| 11 | PF02272.21 | 0.89 | 32 | 2752.0 | same-strand | DHHA1 domain |
| 12 | PF01368.22 | 0.89 | 32 | 2752.0 | same-strand | DHH family |
| 13 | PF02355.18 | 0.94 | 34 | 275.5 | same-strand | Protein export membrane protein |
| 14 | PF07549.16 | 0.92 | 33 | 275 | same-strand | SecD/SecF GG Motif |
| 15 | PF01702.20 | 1.0 | 36 | 26.0 | same-strand | Queuine tRNA-ribosyltransferase |
| 16 | PF02547.17 | 1.0 | 36 | 1183.5 | same-strand | Queuosine biosynthesis protein |
| 17 | PF05496.14 | 1.0 | 36 | 2210.5 | same-strand | Holliday junction DNA helicase RuvB P-loop domain |
| 18 | PF17864.3 | 1.0 | 36 | 2210.5 | same-strand | RuvB AAA lid domain |
| 19 | PF05491.15 | 1.0 | 36 | 2210.5 | same-strand | RuvB C-terminal winged helix domain |
| 20 | PF00004.31 | 1.0 | 36 | 2210.5 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 21 | PF07728.16 | 1.0 | 36 | 2210.5 | same-strand | AAA domain (dynein-related subfamily) |
| 22 | PF01330.23 | 1.0 | 36 | 3248.0 | same-strand | RuvA N terminal domain |
| 23 | PF14520.8 | 1.0 | 36 | 3248.0 | same-strand | Helix-hairpin-helix domain |
| 24 | PF07499.15 | 1.0 | 36 | 3248.0 | same-strand | RuvA, C-terminal domain |
++ More..