Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01408 |
NCBI Accession ID | NC_017340.1 |
Organism | Staphylococcus aureus 04-02981 |
Left | 1444256 |
Right | 1444534 |
Strand | + |
Nucleotide Sequence | GTGGTAAAAATGAGACATATACATTTACAAGTATTCGGACGCGTTCAAGGCGTCGGATTTAGATATTTTACACAACGCATTGCAATGAACTATAACATTGTCGGTACTGTTCAAAATGTAGATGACTATGTAGAGATATATGCACAAGGGGATGACGCAGATATAGAGAGATTTATTCAAGGTGTAATTGAAGGTGCCTCACCAGCATCAAATGTAACAAGCCATCAACTTGAAGAGTTAGAACTAAATCAAAAATTATCGGATTTTCGATCAATATAA |
Sequence | VVKMRHIHLQVFGRVQGVGFRYFTQRIAMNYNIVGTVQNVDDYVEIYAQGDDADIERFIQGVIEGASPASNVTSHQLEELELNQKLSDFRSI |
Source of smORF | Protein-level |
Function | acylphosphatase activity [GO:0003998] The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
Pubmed ID | 30796087 |
Domain | CDD:412440 |
Functional Category | Gene Ontology/Expression based functional assignment |
Uniprot ID | Q7A5P1 |
ORF Length (Amino Acid) | 92 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1346750 | 1347028 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 1447319 | 1447597 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
3 | 1071886 | 1072155 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
4 | 1481091 | 1481360 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
5 | 1583435 | 1583704 | - | NZ_CP018776.1 | Staphylococcus condimenti |
6 | 1186604 | 1186876 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
7 | 1384067 | 1384336 | + | NZ_LT906460.1 | Staphylococcus simiae |
8 | 721106 | 721375 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
9 | 2403959 | 2404231 | + | NZ_CP020773.1 | Staphylococcus lutrae |
10 | 1543914 | 1544183 | - | NZ_AP018587.1 | Staphylococcus caprae |
11 | 1291911 | 1292180 | + | NZ_CP013114.1 | Staphylococcus equorum |
12 | 1502335 | 1502604 | - | NZ_CP008724.1 | Staphylococcus xylosus |
13 | 2557856 | 2558134 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
14 | 1429413 | 1429691 | - | NZ_LR134242.1 | Staphylococcus warneri |
15 | 1512795 | 1513064 | + | NZ_CP033460.1 | Staphylococcus debuckii |
16 | 1887528 | 1887797 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
17 | 1453111 | 1453380 | - | NZ_CP064056.1 | Staphylococcus lloydii |
18 | 922428 | 922706 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
19 | 1415847 | 1416116 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
20 | 689946 | 690215 | - | NZ_CP018199.1 | Staphylococcus succinus |
21 | 1041270 | 1041548 | + | NZ_CP045927.1 | Staphylococcus agnetis |
22 | 1865026 | 1865307 | + | NZ_CP027770.1 | Staphylococcus felis |
23 | 2140782 | 2141063 | - | NZ_CP033732.1 | Staphylococcus hominis |
24 | 1294456 | 1294734 | - | NZ_CP065712.1 | Staphylococcus auricularis |
25 | 1324804 | 1325082 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
26 | 378163 | 378432 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
27 | 1192695 | 1192961 | + | NZ_CP047361.1 | Macrococcus canis |
28 | 1246448 | 1246720 | - | NZ_LT906464.1 | Staphylococcus muscae |
29 | 1313974 | 1314198 | + | NZ_CP054482.1 | Macrococcus bohemicus |
30 | 1515291 | 1515560 | - | NZ_CP008747.1 | Staphylococcus hyicus |
31 | 521981 | 522256 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01168.22 | 0.87 | 27 | 2530.0 | same-strand | Alanine racemase, N-terminal domain |
2 | PF00842.23 | 0.77 | 24 | 2501.0 | same-strand | Alanine racemase, C-terminal domain |
3 | PF02784.18 | 0.97 | 30 | 1290.0 | same-strand | Pyridoxal-dependent decarboxylase, pyridoxal binding domain |
4 | PF00278.24 | 0.97 | 30 | 1290.0 | same-strand | Pyridoxal-dependent decarboxylase, C-terminal sheet domain |
5 | PF00313.24 | 1.0 | 31 | 660 | opposite-strand | 'Cold-shock' DNA-binding domain |
6 | PF10112.11 | 1.0 | 31 | 19 | same-strand | 5-bromo-4-chloroindolyl phosphate hydrolysis protein |
7 | PF05816.13 | 0.97 | 30 | 668.5 | same-strand | Toxic anion resistance protein (TelA) |
8 | PF05525.15 | 0.94 | 29 | 1927 | opposite-strand | Branched-chain amino acid transport protein |
9 | PF07728.16 | 0.65 | 20 | 5275.0 | opposite-strand | AAA domain (dynein-related subfamily) |
10 | PF07726.13 | 0.65 | 20 | 5275.0 | opposite-strand | ATPase family associated with various cellular activities (AAA) |
11 | PF01546.30 | 0.68 | 21 | 3538 | same-strand | Peptidase family M20/M25/M40 |