Result : EXP01403
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01403 |
| NCBI Accession ID | NC_017502.1 |
| Organism | Mycoplasma gallisepticum R(high) |
| Left | 586909 |
| Right | 587208 |
| Strand | - |
| Nucleotide Sequence | ATGGCAAAAATCAAATCATTAAGTGCTGCTGAATATCTTAAAGAAATGGCAGACGAAACTAACCTTAAGGTTCAAGATATCCGTTTAGTTGTTACTTCTTTACAAAAAGTATTAGCTAAAGAACTAGCTACTACTGGTGAAGTAAGATTATTTGATATTGGTAAGTTCAAATTAGTTGCAACTAAACCTCGAACTGGAATCAACCCTAAAACCAAACAAAAGATTCAGATCCCAGCAGGGAAGAAAATCAAACTAACTGTTTCAAAGATCTTAACTGATGCAGTAGATTCGCACAAATAG |
| Sequence | MAKIKSLSAAEYLKEMADETNLKVQDIRLVVTSLQKVLAKELATTGEVRLFDIGKFKLVATKPRTGINPKTKQKIQIPAGKKIKLTVSKILTDAVDSHK |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00257. Profile Description: DNA sequence specific (IHF) and non-specific (HU) domains. This model describes a set of proteins related to but longer than DNA-binding protein HU. Its distinctive domain architecture compared to HU and related histone-like DNA-binding proteins justifies the designation as superfamily. Members include, so far, one from Bacteroides fragilis, a gut bacterium, and ten from Porphyromonas gingivalis, an oral anaerobe. [DNA metabolism, Chromosome-associated proteins] |
| Pubmed ID | 30796087 |
| Domain | CDD:412265 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 540241 | 540540 | - | NC_018406.1 | Mycoplasma gallisepticum VA94_7994-1-7P |
| 2 | 494303 | 494602 | - | NZ_CP059674.1 | Mycoplasma tullyi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_018406.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01751.24 | 1.0 | 2 | 858.5 | same-strand | Toprim domain |
++ More..