Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01401 |
NCBI Accession ID | NC_017502.1 |
Organism | Mycoplasma gallisepticum R(high) |
Left | 36371 |
Right | 36637 |
Strand | + |
Nucleotide Sequence | ATGAAAAGCTTTAAAGCAACTATTATTGATCCATTTGGATTACACGTTAGAACAGCTACTGTTCTATCTTCTAAAATGGGTGGTTTTAAATCAAAAGTTACCCTTAAGATCGTTGGCGGTGCTACTGCTGATGTTAAATCAATTATTAATTTAATGTCTTTAGCTGTTAAGCAAAACACAGCTGTTGAATTCATTATCGAAGGTGAAGATGAAGAGAAAGCTTACGAAGAGCTTCAAAAAGCTTTAAAAGACAATAAATTAATTTAA |
Sequence | MKSFKATIIDPFGLHVRTATVLSSKMGGFKSKVTLKIVGGATADVKSIINLMSLAVKQNTAVEFIIEGEDEEKAYEELQKALKDNKLI |
Source of smORF | Protein-level |
Function | The ORF matches to the profile of cl00206. Profile Description: N/A. The HPr family are bacterial proteins (or domains of proteins) which function in phosphoryl transfer system (PTS) systems. They include energy-coupling components which catalyze sugar uptake via a group translocation mechanism. The functions of most of these proteins are not known, but they presumably function in PTS-related regulatory capacities. All seed members are stand-alone HPr proteins, although the model also recognizes HPr domains of PTS fusion proteins. This family includes the related NPr protein. [Signal transduction, PTS] |
Pubmed ID | 30796087 |
Domain | CDD:412221 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 88 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 36350 | 36616 | + | NC_018406.1 | Mycoplasma gallisepticum VA94_7994-1-7P |
2 | 33193 | 33459 | + | NZ_CP059674.1 | Mycoplasma tullyi |
3 | 87874 | 88140 | - | NZ_LR214950.1 | Mycoplasmopsis gallinacea |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01434.20 | 0.67 | 2 | 1617.5 | same-strand | Peptidase family M41 |
2 | PF00004.31 | 0.67 | 2 | 1617.5 | same-strand | ATPase family associated with various cellular activities (AAA) |
3 | PF17862.3 | 0.67 | 2 | 1617.5 | same-strand | AAA+ lid domain |
4 | PF02779.26 | 0.67 | 2 | 1118.0 | same-strand | Transketolase, pyrimidine binding domain |
5 | PF07517.16 | 0.67 | 2 | 2139.0 | same-strand | SecA DEAD-like domain |
6 | PF01043.22 | 0.67 | 2 | 2139.0 | same-strand | SecA preprotein cross-linking domain |