Result : EXP01401
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01401 |
| NCBI Accession ID | NC_017502.1 |
| Organism | Mycoplasma gallisepticum R(high) |
| Left | 36371 |
| Right | 36637 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAGCTTTAAAGCAACTATTATTGATCCATTTGGATTACACGTTAGAACAGCTACTGTTCTATCTTCTAAAATGGGTGGTTTTAAATCAAAAGTTACCCTTAAGATCGTTGGCGGTGCTACTGCTGATGTTAAATCAATTATTAATTTAATGTCTTTAGCTGTTAAGCAAAACACAGCTGTTGAATTCATTATCGAAGGTGAAGATGAAGAGAAAGCTTACGAAGAGCTTCAAAAAGCTTTAAAAGACAATAAATTAATTTAA |
| Sequence | MKSFKATIIDPFGLHVRTATVLSSKMGGFKSKVTLKIVGGATADVKSIINLMSLAVKQNTAVEFIIEGEDEEKAYEELQKALKDNKLI |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00206. Profile Description: N/A. The HPr family are bacterial proteins (or domains of proteins) which function in phosphoryl transfer system (PTS) systems. They include energy-coupling components which catalyze sugar uptake via a group translocation mechanism. The functions of most of these proteins are not known, but they presumably function in PTS-related regulatory capacities. All seed members are stand-alone HPr proteins, although the model also recognizes HPr domains of PTS fusion proteins. This family includes the related NPr protein. [Signal transduction, PTS] |
| Pubmed ID | 30796087 |
| Domain | CDD:412221 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 36350 | 36616 | + | NC_018406.1 | Mycoplasma gallisepticum VA94_7994-1-7P |
| 2 | 33193 | 33459 | + | NZ_CP059674.1 | Mycoplasma tullyi |
| 3 | 87874 | 88140 | - | NZ_LR214950.1 | Mycoplasmopsis gallinacea |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_018406.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01434.20 | 0.67 | 2 | 1617.5 | same-strand | Peptidase family M41 |
| 2 | PF00004.31 | 0.67 | 2 | 1617.5 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 3 | PF17862.3 | 0.67 | 2 | 1617.5 | same-strand | AAA+ lid domain |
| 4 | PF02779.26 | 0.67 | 2 | 1118.0 | same-strand | Transketolase, pyrimidine binding domain |
| 5 | PF07517.16 | 0.67 | 2 | 2139.0 | same-strand | SecA DEAD-like domain |
| 6 | PF01043.22 | 0.67 | 2 | 2139.0 | same-strand | SecA preprotein cross-linking domain |
++ More..