Result : EXP01400
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01400 |
| NCBI Accession ID | NC_017340.1 |
| Organism | Staphylococcus aureus 04-02981 |
| Left | 1294753 |
| Right | 1295037 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAAGAAAAAAATTCCGATGCGAAAATGTATTCTTTCAAATGAAATGCATCCCAAAAAAGATATGATTCGTGTTGTTGTTAATAAAGAAGGCGAAATCTTTGCGGATGTTACTGGAAAGAAACAAGGCCGTGGCGCATATGTTTCTAAAGATGTTGCTATGGTTGAAAAAGCACAACAAAAAGAAATTTTAGAAAAATATTTTAAAGCATCTAAAGAGCAATTGGATCCTGTTTACAAAGAAATTATTAGATTAATTTATAGAGAAGAGATTCCAAAATGA |
| Sequence | MKKKKIPMRKCILSNEMHPKKDMIRVVVNKEGEIFADVTGKKQGRGAYVSKDVAMVEKAQQKEILEKYFKASKEQLDPVYKEIIRLIYREEIPK |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00189. Profile Description: N/A. Ylxr homologs; group of conserved hypothetical bacterial proteins of unknown function; structure revealed putative RNA binding cleft; proteins are encoded by an operon that includes other proteins involved in transcription and/or translation |
| Pubmed ID | 30796087 |
| Domain | CDD:412207 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 64
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1195809 | 1196093 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1266454 | 1266738 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1569229 | 1569516 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 4 | 578196 | 578480 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 5 | 2411385 | 2411672 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 6 | 1629348 | 1629632 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 7 | 1220138 | 1220422 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 8 | 1593359 | 1593643 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 9 | 1692079 | 1692363 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 10 | 1747450 | 1747734 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 11 | 1668504 | 1668788 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 12 | 518765 | 519049 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 13 | 881414 | 881698 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 14 | 1120513 | 1120797 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 15 | 1573829 | 1574113 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 16 | 926706 | 926990 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 17 | 1743647 | 1743934 | + | NZ_CP027770.1 | Staphylococcus felis |
| 18 | 1734906 | 1735190 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 19 | 1356204 | 1356488 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 20 | 909406 | 909693 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 21 | 898570 | 898857 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 22 | 1651423 | 1651710 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 23 | 1052219 | 1052506 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 24 | 2256418 | 2256705 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 25 | 227075 | 227311 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 26 | 57329 | 57565 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 27 | 1424875 | 1425159 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 28 | 1504241 | 1504525 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 29 | 1426186 | 1426470 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 30 | 728357 | 728641 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 31 | 1044504 | 1044791 | + | NZ_CP047361.1 | Macrococcus canis |
| 32 | 676372 | 676659 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 33 | 1188655 | 1188894 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 34 | 1144048 | 1144335 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 35 | 1156809 | 1157096 | + | NZ_CP046314.1 | Gemella morbillorum |
| 36 | 935722 | 936009 | - | NZ_CP019573.1 | Abyssicoccus albus |
| 37 | 1049620 | 1049907 | - | NZ_LR134484.1 | Gemella haemolysans |
| 38 | 1335652 | 1335924 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 39 | 1635554 | 1635784 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 40 | 1615509 | 1615751 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 41 | 2079779 | 2080057 | - | NZ_CP016540.2 | Planococcus versutus |
| 42 | 401777 | 402055 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 43 | 1917949 | 1918179 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 44 | 1695324 | 1695554 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 45 | 2072191 | 2072466 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 46 | 2386159 | 2386434 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 47 | 1532407 | 1532661 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 48 | 1416170 | 1416475 | + | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 49 | 89680 | 89964 | + | NZ_CP049889.1 | Jeotgalibaca porci |
| 50 | 1210524 | 1210823 | - | NZ_CP013988.1 | Aerococcus urinaeequi |
| 51 | 1456400 | 1456684 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 52 | 902184 | 902480 | + | NZ_CP014161.1 | Aerococcus urinae |
| 53 | 2608594 | 2608833 | - | NZ_LS483476.1 | Lederbergia lentus |
| 54 | 1389832 | 1390128 | - | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 55 | 1830340 | 1830570 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 56 | 202657 | 202899 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 57 | 1925138 | 1925392 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 58 | 983346 | 983645 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 59 | 3676542 | 3676820 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 60 | 1491539 | 1491778 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 61 | 1456251 | 1456529 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 62 | 774675 | 774977 | + | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 63 | 2223097 | 2223327 | - | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 64 | 1000319 | 1000549 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02163.24 | 0.88 | 56 | 8122.0 | same-strand | Peptidase family M50 |
| 2 | PF17820.3 | 0.84 | 54 | 8122.0 | same-strand | PDZ domain |
| 3 | PF00587.27 | 0.83 | 53 | 6409 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 4 | PF04073.17 | 0.83 | 53 | 6409 | same-strand | Aminoacyl-tRNA editing domain |
| 5 | PF03129.22 | 0.83 | 53 | 6409 | same-strand | Anticodon binding domain |
| 6 | PF02811.21 | 0.94 | 60 | 1908.5 | same-strand | PHP domain |
| 7 | PF00929.26 | 0.94 | 60 | 1908.5 | same-strand | Exonuclease |
| 8 | PF17657.3 | 0.94 | 60 | 1908.5 | same-strand | Bacterial DNA polymerase III alpha subunit finger domain |
| 9 | PF11490.10 | 0.92 | 59 | 1909 | same-strand | DNA polymerase III polC-type N-terminus II |
| 10 | PF14480.8 | 0.94 | 60 | 1908.5 | same-strand | DNA polymerase III polC-type N-terminus I |
| 11 | PF14579.8 | 0.92 | 59 | 1909 | same-strand | Helix-hairpin-helix motif |
| 12 | PF02576.19 | 1.0 | 64 | 1217.0 | same-strand | RimP N-terminal domain |
| 13 | PF17384.4 | 1.0 | 64 | 1217.0 | same-strand | RimP C-terminal SH3 domain |
| 14 | PF08529.13 | 1.0 | 64 | 19.0 | same-strand | NusA N-terminal domain |
| 15 | PF13184.8 | 1.0 | 64 | 19.0 | same-strand | NusA-like KH domain |
| 16 | PF00575.25 | 0.89 | 57 | 19 | same-strand | S1 RNA binding domain |
| 17 | PF01248.28 | 0.98 | 63 | -3 | same-strand | Ribosomal protein L7Ae/L30e/S12e/Gadd45 family |
| 18 | PF11987.10 | 1.0 | 64 | 319.0 | same-strand | Translation-initiation factor 2 |
| 19 | PF00009.29 | 1.0 | 64 | 319.0 | same-strand | Elongation factor Tu GTP binding domain |
| 20 | PF04760.17 | 1.0 | 64 | 319.0 | same-strand | Translation initiation factor IF-2, N-terminal region |
| 21 | PF01926.25 | 1.0 | 64 | 319.0 | same-strand | 50S ribosome-binding GTPase |
| 22 | PF00025.23 | 0.84 | 54 | 319.0 | same-strand | ADP-ribosylation factor family |
| 23 | PF02033.20 | 0.89 | 57 | 2805 | same-strand | Ribosome-binding factor A |
| 24 | PF01509.20 | 0.69 | 44 | 3301.0 | same-strand | TruB family pseudouridylate synthase (N terminal domain) |
| 25 | PF16198.7 | 0.67 | 43 | 3327 | same-strand | tRNA pseudouridylate synthase B C-terminal domain |
++ More..