Result : EXP01387
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01387 |
| NCBI Accession ID | NC_007633.1 |
| Organism | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| Left | 399217 |
| Right | 399504 |
| Strand | - |
| Nucleotide Sequence | ATGATTATGACAAATACTATGATTAATAAAAATAAGAATCTAAGAAAAGATATCGCTTCAAATCAAATGTTAGAAAAGCATCAATTAATTAGAATTGTTAAAAATAAAAATGACGAGATTTTTATTGATACTACTTATAAAGCTAATGGTAGAGGTGTTTATCTAAAACCAGATTTAAATAGTTTAAAAATAGCAAGAGAAAAAAATTTGATTGCAAAAAGTTTAAAATCAAAAATAGATGTATCTATTTATGATCAACTAGAAGAATTTATTAATGCAAAAAGATAA |
| Sequence | MIMTNTMINKNKNLRKDIASNQMLEKHQLIRIVKNKNDEIFIDTTYKANGRGVYLKPDLNSLKIAREKNLIAKSLKSKIDVSIYDQLEEFINAKR |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00189. Profile Description: N/A. Ylxr homologs; group of conserved hypothetical bacterial proteins of unknown function; structure revealed putative RNA binding cleft; proteins are encoded by an operon that includes other proteins involved in transcription and/or translation |
| Pubmed ID | 30796087 |
| Domain | CDD:412207 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 399217 | 399504 | - | NC_007633.1 | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| 2 | 382731 | 383000 | - | NZ_CP001668.1 | Mycoplasma mycoides subsp. capri str. GM12 |
| 3 | 246705 | 246974 | + | NZ_CP007520.1 | Mycoplasma yeatsii GM274B |
| 4 | 348626 | 348889 | + | NZ_CP024411.1 | Mesoplasma entomophilum |
| 5 | 359706 | 359969 | + | NZ_CP023173.1 | Mesoplasma chauliocola |
| 6 | 338306 | 338569 | + | NC_006055.1 | Mesoplasma florum L1 |
| 7 | 352248 | 352511 | + | NZ_CP024969.1 | Mesoplasma tabanidae |
| 8 | 530418 | 530684 | - | NZ_LS991954.1 | Mycoplasma putrefaciens |
| 9 | 392322 | 392585 | + | NZ_CP024964.1 | Entomoplasma melaleucae |
| 10 | 401170 | 401433 | + | NZ_CP025257.1 | Mesoplasma syrphidae |
| 11 | 379067 | 379354 | + | NZ_CP024965.1 | Entomoplasma somnilux |
| 12 | 437373 | 437639 | + | NZ_CP006681.1 | Spiroplasma culicicola AES-1 |
| 13 | 652364 | 652639 | - | NZ_CP006934.1 | Spiroplasma sabaudiense Ar-1343 |
| 14 | 592986 | 593252 | + | NZ_CP043026.1 | Spiroplasma chinense |
| 15 | 425581 | 425850 | + | NZ_CP038013.1 | Spiroplasma gladiatoris |
| 16 | 1087518 | 1087790 | - | NZ_CP024870.1 | Spiroplasma clarkii |
| 17 | 365064 | 365348 | + | NZ_CP012328.1 | Spiroplasma turonicum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007633.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00009.29 | 1.0 | 17 | 312 | same-strand | Elongation factor Tu GTP binding domain |
| 2 | PF11987.10 | 1.0 | 17 | 312 | same-strand | Translation-initiation factor 2 |
| 3 | PF01926.25 | 1.0 | 17 | 312 | same-strand | 50S ribosome-binding GTPase |
| 4 | PF04760.17 | 0.76 | 13 | 308 | same-strand | Translation initiation factor IF-2, N-terminal region |
| 5 | PF00071.24 | 1.0 | 17 | 312 | same-strand | Ras family |
| 6 | PF01248.28 | 0.71 | 12 | -13.0 | same-strand | Ribosomal protein L7Ae/L30e/S12e/Gadd45 family |
++ More..