Result : EXP01385
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01385 |
| NCBI Accession ID | NC_017340.1 |
| Organism | Staphylococcus aureus 04-02981 |
| Left | 1078628 |
| Right | 1078891 |
| Strand | + |
| Nucleotide Sequence | ATGAAAACAATTGAACTACATATCACATTACAACCACAAGTATTAGATACGCAAGGACAAACGCTTACTCGAGCTGTACATGACTTAGGTTATGCACAAGTGAATGATATTCGTGTAGGAAAAGTATTATATATGACAGTGGATGAGGTTAGTGATGAAAAGGTACACAACATTATTACAACTCTAAGTGAAAAATTGTTTGCAAATACAGTGATTGAAGAATATAGCTATAAAGTGTTAGATGATGAAAAGGAGAATGCATAA |
| Sequence | MKTIELHITLQPQVLDTQGQTLTRAVHDLGYAQVNDIRVGKVLYMTVDEVSDEKVHNIITTLSEKLFANTVIEEYSYKVLDDEKENA |
| Source of smORF | Protein-level |
| Function | The ORF matches to the profile of cl00789. Profile Description: Phosphoribosylformylglycinamidine (FGAM) synthase. phosphoribosylformylglycinamidine synthase subunit PurS; Reviewed |
| Pubmed ID | 30796087 |
| Domain | CDD:412569 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 35
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 981623 | 981886 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1052059 | 1052319 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1030662 | 1030922 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 689123 | 689383 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 5 | 814367 | 814627 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 6 | 1530906 | 1531166 | + | NZ_CP027770.1 | Staphylococcus felis |
| 7 | 2025114 | 2025374 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 8 | 1945355 | 1945615 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 9 | 249489 | 249749 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 10 | 1755000 | 1755260 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 11 | 2225385 | 2225645 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 12 | 1950858 | 1951124 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 13 | 373788 | 374048 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 14 | 711271 | 711531 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 15 | 868919 | 869179 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 16 | 1113144 | 1113410 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 17 | 734904 | 735164 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 18 | 1874458 | 1874718 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 19 | 1825472 | 1825732 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 20 | 1782845 | 1783105 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 21 | 1555432 | 1555692 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 22 | 1090938 | 1091198 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 23 | 1848881 | 1849150 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 24 | 665286 | 665555 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 25 | 35797 | 36057 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 26 | 1786784 | 1787044 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 27 | 872383 | 872643 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 28 | 851881 | 852141 | + | NZ_CP047361.1 | Macrococcus canis |
| 29 | 921416 | 921676 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 30 | 1613960 | 1614223 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 31 | 1730460 | 1730720 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 32 | 1637328 | 1637588 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 33 | 518327 | 518587 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 34 | 508378 | 508641 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 35 | 1009345 | 1009602 | + | NZ_CP011366.1 | Salinicoccus halodurans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02882.21 | 1.0 | 35 | 2509 | opposite-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain |
| 2 | PF00763.25 | 1.0 | 35 | 2509 | opposite-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain |
| 3 | PF00731.22 | 1.0 | 35 | 1819 | same-strand | AIR carboxylase |
| 4 | PF02222.24 | 1.0 | 35 | 705 | same-strand | ATP-grasp domain |
| 5 | PF17769.3 | 1.0 | 35 | 705 | same-strand | Phosphoribosylaminoimidazole carboxylase C-terminal domain |
| 6 | PF02786.19 | 1.0 | 35 | 705 | same-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
| 7 | PF02655.16 | 0.8 | 28 | 705.0 | same-strand | ATP-grasp domain |
| 8 | PF01259.20 | 1.0 | 35 | 0 | same-strand | SAICAR synthetase |
| 9 | PF13507.8 | 1.0 | 35 | 0 | same-strand | CobB/CobQ-like glutamine amidotransferase domain |
| 10 | PF00117.30 | 0.69 | 24 | 0.0 | same-strand | Glutamine amidotransferase class-I |
| 11 | PF00586.26 | 1.0 | 35 | 2455.0 | same-strand | AIR synthase related protein, N-terminal domain |
| 12 | PF02769.24 | 1.0 | 35 | 2455.0 | same-strand | AIR synthase related protein, C-terminal domain |
| 13 | PF18072.3 | 1.0 | 35 | 665 | same-strand | Formylglycinamide ribonucleotide amidotransferase linker domain |
| 14 | PF13537.8 | 1.0 | 35 | 2832 | same-strand | Glutamine amidotransferase domain |
| 15 | PF13522.8 | 1.0 | 35 | 2832 | same-strand | Glutamine amidotransferase domain |
| 16 | PF00551.21 | 1.0 | 35 | 5342 | same-strand | Formyl transferase |
++ More..