Result : EXP01371
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01371 |
| NCBI Accession ID | NC_007633.1 |
| Organism | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| Left | 627223 |
| Right | 627525 |
| Strand | - |
| Nucleotide Sequence | ATGTATATAGATATAGAAAAAAATACTAAAGGTAATTTACAAATAGAAAAAAAAGTTATTAATAGATTAATTGAAAATGTAATTTTATCAACTACTAAAATTTCAAATCCACAAGATGTTAGTTCTTCTATTTATTTGCTTGAAGAAAACCAGTTGCACATACTAACAACCATTAGAATTCAAGATCAAAAATTACAAGATTTAAATATTAATGAAGATAAAATTTTTAAAGCTATTGATAAAATAATGAACCAAACAATTTCTATAAAACCTAAAAACATCAATATATCATATATAAAATAG |
| Sequence | MYIDIEKNTKGNLQIEKKVINRLIENVILSTTKISNPQDVSSSIYLLEENQLHILTTIRIQDQKLQDLNINEDKIFKAIDKIMNQTISIKPKNINISYIK |
| Source of smORF | Protein-level |
| Function | |
| Pubmed ID | 30796087 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 627223 | 627525 | - | NC_007633.1 | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| 2 | 482639 | 482941 | + | NZ_CP001668.1 | Mycoplasma mycoides subsp. capri str. GM12 |
| 3 | 351434 | 351733 | + | NZ_LS991954.1 | Mycoplasma putrefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007633.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF16193.7 | 0.67 | 2 | 3927.0 | same-strand | AAA C-terminal domain |
| 2 | PF00004.31 | 0.67 | 2 | 3874 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 3 | PF13173.8 | 0.67 | 2 | 3927.0 | same-strand | AAA domain |
| 4 | PF05362.15 | 1.0 | 3 | 2634 | same-strand | Lon protease (S16) C-terminal proteolytic domain |
| 5 | PF13541.8 | 1.0 | 3 | 2634 | same-strand | Subunit ChlI of Mg-chelatase |
| 6 | PF05698.16 | 1.0 | 3 | 452 | same-strand | Bacterial trigger factor protein (TF) C-terminus |
| 7 | PF09285.13 | 1.0 | 3 | 18 | same-strand | Elongation factor P, C-terminal |
| 8 | PF08207.14 | 1.0 | 3 | 276 | same-strand | Elongation factor P (EF-P) KOW-like domain |
| 9 | PF00551.21 | 1.0 | 3 | 968 | same-strand | Formyl transferase |
| 10 | PF11074.10 | 1.0 | 3 | 1887 | same-strand | Domain of unknown function(DUF2779) |
++ More..